KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_I0001Help
Entry
Vch1786_I0001     CDS       T01650                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Vch1786_I0001
Enzymes [BR:vce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Vch1786_I0001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(36..539)
Genome map
AA seq 167 aa AA seqDB search
MMLAYIAIGSNLGDPVAQAQLAIQQLTLLPKSRLIAASSLYSSTPMGPQNQPDYINAVAA
IETELTPLELLDCTQRIELEQGRVRKSERWGPRTLDLDIVLYGNEVIETERLTIPHYGMK
VREFVLYPLAEIAPNLTLPDGTEIQALLQQVPLNGLSIWHSPTSSKD
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgatgcttgcctacattgcgattggcagtaatttgggcgaccctgtcgcccaagcacag
ctggccatacaacagcttactctcttaccgaagtcgcgccttatcgcggcttcatcgctc
tatagcagcactccgatggggccgcaaaatcagcctgattacatcaacgctgtcgccgcc
atcgaaaccgaattaacgccactggaattgctcgattgcacacaacgcattgagctagaa
caggggcgtgtccgtaaaagcgaacgatggggaccgagaaccctcgatctcgatattgtg
ctttacggcaatgaggtgatagagaccgagcgcctcaccattcctcactatggaatgaaa
gtacgtgaattcgtgctttacccgctcgcggaaatcgcaccaaatttaaccctcccagac
gggactgaaatccaagcgttattgcaacaagtaccgctcaatgggctcagcatttggcac
tcgccaacgtcgagtaaggactaa

DBGET integrated database retrieval system