KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_I0021Help
Entry
Vch1786_I0021     CDS       T01650                                 

Gene name
chb-1
Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vce00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Vch1786_I0021 (chb-1)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Vch1786_I0021 (chb-1)
Enzymes [BR:vce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Vch1786_I0021 (chb-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(26539..28452)
Genome map
AA seq 637 aa AA seqDB search
MSYRIEFAVLSEQKPDCRFGLTLHNLSDQDLHDWSLYFVIDRYIQPMSVTNGQLTQVGSL
CSIVPTEKVLQANGHFYCEFIIKTAPYHFYTDGVKHAFVQLNDKQPVERINVAVNPIVLA
SPFRERSQIPEVTAAELCLIPKPNSLQRFQGEFVVNHSSQISLQSDSAARAARWLEQELH
ALHEFKLNTVGHSDIVYRSNPTLDEGHYQLNIEAQGIKIEAGSHSGFMHASATLLQLAQA
HQGSLRFPLVNIVDAPRFKYRGMMLDCARHFHSLEQVKRVINQLAHYKFNVFHWHLTDDE
GWRIEIKRLPQLTDIGAWRGMDEVLEPQYSLLTERHGGFYTQDEIRAVIEYASDRGITVI
PEIDVPGHSRAAIKALPAWLVDEEDCSQYRSIQYYNDNVLSPALPGTYQFLDIVLEEVAA
LFPSQFIHIGADEVPHGVWVDSPKCQALMQEQGYTDPKELQGHLLRYAEKKLKSLGKRMV
GWEEAHHGDKVSKDTVIYSWLSEKAALDCAKQGFDVILQPGQFTYLDIVQDYAPEEPGVD
WAGVTPLERAYGYEPLADVPANDPLRKRILGIQCALWCELINNSERMEYMLYPRLTALAE
GGWTEKSQRDWLDYLARLKGHLPLLDKQKIPYRAPWK
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgagttatcgaattgaatttgcggtgctctcggaacaaaaaccggattgccgttttggt
ttaaccctgcacaatttgagcgatcaagatctgcatgattggtcgctgtattttgtgatt
gatcgttacatccaacccatgagtgtgaccaacggtcaactgacccaagtcggcagctta
tgttcgattgttccaacggaaaaagtgttgcaagctaatggccacttttattgtgagttc
atcatcaaaaccgcgccttaccatttctacaccgatggggtaaagcacgcgtttgtccaa
cttaatgataaacagcctgttgaacgtattaacgtcgcggttaaccctatcgttctcgcg
tcaccatttcgcgagcgtagccagatccctgaagtgactgcggctgagctctgtctcatc
cccaaacctaactcactgcaacgtttccaaggtgagtttgtggtcaaccactccagccag
atctcgctgcaatcggactcggccgcgcgtgctgcacgctggttagagcaagaattgcat
gcactgcatgagttcaaactgaatacggttggccatagcgatatcgtctaccgcagtaat
cccacgctcgatgagggccattaccaactcaatatcgaagcgcaagggatcaagattgaa
gcaggcagccacagtggctttatgcatgccagcgcgactttgctgcaactggcgcaagcg
catcaaggctcattgcgctttcctctggtcaacattgtcgatgcaccgcgctttaagtat
cgcggtatgatgctcgattgcgcccgccattttcactcgcttgagcaggtcaaacgagtg
atcaatcaactggcacactacaaatttaacgtgttccactggcatctgactgatgatgaa
ggttggcgtattgagattaaacgcctgccgcaactgacagacattggtgcatggcgtggc
atggatgaagtgctggaacctcagtacagcttactcacggagcgtcatggcggtttctat
acccaagatgagatccgtgcagtgattgagtacgccagcgatcgtggcattactgtcatc
cctgaaattgacgtaccagggcacagccgcgccgcgattaaagcgctgccggcatggctg
gtcgatgaggaagattgctcgcaatatcgcagtattcagtactacaacgacaacgtgctc
tcccctgcactgccgggcacttatcaattcctcgacatcgtattggaagaagtggctgcg
ctgtttccaagccaatttattcatatcggtgccgatgaagtcccacacggtgtgtgggta
gatagcccgaaatgccaagccttaatgcaagagcaaggctataccgacccgaaagagctg
caaggccacttactgcgctacgccgagaaaaaactcaagagcttgggtaagcgtatggtc
ggctgggaagaagctcatcacggcgacaaagtgagtaaagatacggtgatttactcttgg
ctatcggaaaaagccgccttggattgcgccaaacaaggctttgacgtgattttgcagccg
ggacaatttacctatctcgatatcgttcaagactacgctcctgaagaaccgggcgtggat
tgggcgggtgttactccgctagagcgtgcttacggttatgaaccgttagccgacgttccg
gccaatgacccactgcgtaaacgcattttaggtattcaatgcgccttgtggtgtgaattg
atcaataactcagaacgcatggaatacatgctctatccacgtctcacggcattagcagaa
ggcggttggacagagaaatcccagcgtgactggttggattatctagcgcgtttgaaaggc
catttaccactgctggataagcagaaaataccttatcgcgcgccttggaagtaa

DBGET integrated database retrieval system