KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_I0046Help
Entry
Vch1786_I0046     CDS       T01650                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vce00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:59792..60628
Genome map
AA seq 278 aa AA seqDB search
MLKISHADKQLELHSPVVMGILNTTPDSFSDGGRYVDLDVALARAQQMIDLGVAIIDIGG
ESTRPGAPDVALEEELQRVIPLIKAIRKQNAEVWISIDTSKAEVMRQALAAGADLINDVR
ALQEPGALEVAAQAQVPVCIMHMQGQPRTMQANPHYYNIIEEVCQFLAERIAQCEAAGIK
RENIILDPGFGFGKSVQHNYHLLAHLEQFHRFGLPVLAGMSRKSMIFKTLNKQPAECVAG
SVACATLAAQKGAQIIRVHDVEQTIDALKMVQMMHNNL
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaatcagtcatgccgataagcagcttgagctgcattcacccgttgtgatgggt
atcttaaatactacgccagattccttttccgatggcggccgttacgttgaccttgatgtc
gcgttggcaagagcacagcaaatgatcgaccttggcgtcgcgattattgatattggcggt
gagtcaactcgaccaggcgctcctgatgttgctttagaagaggaattacagcgcgtcatc
ccacttatcaaagcgattcgaaaacagaatgctgaggtatggatttcgattgataccagc
aaagcggaagtgatgcgccaagcattagctgcgggagccgatctgattaatgatgtgcgt
gctttgcaagagccgggagctcttgaagtagcagcgcaggctcaagtcccggtttgtatt
atgcatatgcaaggtcagccgcggacgatgcaagctaacccacactactacaatattatt
gaagaggtttgccagtttttagctgagcgaattgcacaatgcgaagctgcgggtattaag
cgtgagaatattatcttagatcccggttttggttttggaaaatcggtgcaacacaattat
catttgctcgcccatttagaacagtttcatcgttttggattgccagttttagctggaatg
tcacgtaaatcaatgatttttaaaacactgaataagcaaccagctgaatgtgtggcagga
agcgttgcgtgtgccacattggctgcgcaaaaaggcgcacaaattatccgtgttcatgat
gtagagcagaccattgatgcactcaaaatggtgcagatgatgcataacaatttgtaa

DBGET integrated database retrieval system