KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_I0241Help
Entry
Vch1786_I0241     CDS       T01650                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Vch1786_I0241
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Vch1786_I0241
   00630 Glyoxylate and dicarboxylate metabolism
    Vch1786_I0241
Enzymes [BR:vce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Vch1786_I0241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:266479..268116
Genome map
AA seq 545 aa AA seqDB search
MSINTAELTQHTTETKITQGKLAVVGTLSPEHQAIFPVEAQTFLQQLCERFAPRVDELLT
LREQKQTLIDQGQLPDFLPETKDIREGSWKILGIPDDLQDRRVEITGPTDRKMVINALNA
NVKVFMADFEDSMSPAWDKVLDGQINLRDAILGSISYTNPDNGKRYELNANPAVLICRVR
GLHLKEKHVTYNGLAIPGSLFDFALYFYNNHRALLKKGSGPYFYLPKLQAYQEAQWWSDV
FHFTEDYFGLDTGTIKATVLIETLPAVFQMDEILFSLKEHIVGLNCGRWDYIFSYIKTLK
KHPDRVLPDRQVVTMDKPFLNAYSRLLIYTCHKRGAFAMGGMAAFIPAKDPALNEQVLQK
IRGDKMLEATNGHDGTWVAHPGLADTAMAVFNEVLGERKNQLNVSRMADAPITAAELLAP
CDGSRSEHGMRHNIRVALQYIEAWISGNGCVPIYGLMEDAATAEISRASIWQWIQHGKTL
DNGQVVTNELFRDYLKQEIEVVKSEVGESRFAQGRFTEAAELMERLTTSQELPNFLTIPG
YDYLP
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatcaatactgctgaattaacccaacacaccacggaaaccaaaatcacccaaggc
aagcttgctgttgtgggtaccctttcacccgaacatcaagcgattttccctgtcgaagcc
caaacttttttacagcaactctgtgagcgctttgcgccgcgagtggatgaattactgacc
ttgcgtgaacaaaaacaaacgcttatcgaccaaggccagctacctgattttcttcctgaa
accaaagatatccgtgaaggaagctggaagattctcggcattccagacgatctgcaagat
cgtcgcgtagagatcacggggccaaccgatcgcaaaatggtgattaatgcactgaacgcg
aatgtgaaagtctttatggctgactttgaagattcgatgtcgcccgcgtgggataaggtg
ttggatgggcagatcaacctgcgtgatgcgattctgggcagcataagctataccaaccca
gacaatggcaagcgttatgagctcaatgccaacccagcggtgctcatctgccgcgtgcgc
ggtctgcatctcaaagaaaaacatgtcacctacaacggcttggcgattcccggttcactg
ttcgattttgcgctctatttttacaacaaccatcgcgcactattgaaaaaaggcagtggc
ccttatttctacctacctaagctgcaagcttatcaagaggcgcagtggtggagtgacgtg
ttccatttcacggaagattattttggcttagacacaggcaccatcaaagcaacggtgttg
attgaaactctgcctgcggtatttcagatggatgagatcctcttctcactcaaagagcac
attgtcggtctgaactgtggacgctgggattatattttcagctacatcaaaaccttgaaa
aagcatcccgaccgcgtattgccggatcgccaagtggtgaccatggataagcctttcctc
aatgcgtattcccgtttgttgatttacacctgtcataaacgcggcgcgtttgcgatgggc
gggatggcggcgtttattccagccaaagatcctgcgctcaatgaacaagtgctacaaaaa
attcgcggcgacaaaatgcttgaagcgaccaatggccacgatggcacttgggttgctcac
cccggtttagcggataccgcgatggcggtgtttaacgaagtgcttggtgagcgcaaaaac
caactcaatgtgagccggatggccgatgctccgataaccgcggccgagctattggcacct
tgcgatggatcacgctctgagcatggcatgcgccacaacattcgcgttgcgttgcaatac
atcgaagcatggatttctggtaacggttgtgtgccgatctacggcttgatggaagatgcg
gcgacagcggagatttcacgcgcttcgatttggcaatggatccaacacggcaaaacgtta
gataacgggcaagtggtcactaacgaactgtttcgcgactacctcaaacaagagattgag
gtggtgaaaagcgaagtgggtgagtcccgttttgcacaagggcgttttactgaagcggcc
gaattgatggagcgcttaacgaccagccaagagctaccgaatttcttaaccatacctggc
tacgactacttgccgtag

DBGET integrated database retrieval system