KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_I0305Help
Entry
Vch1786_I0305     CDS       T01650                                 

Gene name
citF
Definition
citrate lyase, alpha subunit
Orthology
K01643  
citrate lyase subunit alpha / citrate CoA-transferase [EC:4.1.3.6 2.8.3.10]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
Citrate cycle (TCA cycle)
Biosynthesis of secondary metabolites
Two-component system
Class
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:vce00020]
Environmental Information Processing; Signal transduction; Two-component system [PATH:vce02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:332965..334494
Genome map
AA seq 509 aa AA seqDB search
MSINTLNNPLSVLEVERYALTPYTQARAITPHLHDEQAKKSRKVKSSIREAIVDLGLKDG
MTISFHHAFRGGDKTVNLVMEVIAELGIKNLTLASSSLTSCHSPLIEHIKNGVVSKIYTS
GIRGALADSISNGLLDEPVHIHSHGGRVHLIQSGELYIDMAFIGVPCCDEFGNANGFKGK
SNCGSLGYAKVDAEHAEKVVMLTEAIVGFPNFPASITQDRVDAVVQVAEVGDPSKIGGDA
TRMTTNPRELLIAKRAAEVIEHSGYFYDGFSMQTGSGGASLAVARFLKEKMLRQDIRASF
ALGGITATMVDMHEQGLIDYLLDVQCFDSVAAGSLARNPHHLEISANEYANPSSKGAAVD
RLDVVILSALEIDTQFNVNVITGSDGVIRGASGGHCDTAAAANLSIIVAPLVRGRIPTVV
EKVTNVITPGSTIDVLVTDQGIAVNPNRPELKARFIEAQLPVVEIEALQQRAELLTGKPQ
PLQFEDKTVAFVHYRDGSIIDVIKQVKSL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcaatacattaaataaccctctgtctgtgctggaagtggaacgctacgcgttg
acgccttacacccaagcgcgcgcgatcacgccgcatctgcacgatgagcaagcgaaaaaa
agccgcaaagtgaaaagctcgatccgcgaagcgattgtcgatcttggcttaaaagatggc
atgaccatctctttccaccatgcgtttcgtggcggcgataaaaccgtcaatctggtgatg
gaggtgattgctgaattgggaattaaaaatctcacgctcgcctcaagctcgctgacctct
tgtcattcgcctttgattgaacacatcaaaaacggcgtagtgagcaagatttacacctca
gggatccgcggagcgctggccgacagcatttctaacggcctgcttgatgagcccgtgcat
attcactcgcacggtggtcgtgtgcatttgatccaaagcggtgagctgtacatcgacatg
gcgtttattggcgtaccttgttgcgatgaatttggtaacgctaacggttttaaaggcaag
tccaattgtggctcactcggctatgccaaagttgatgccgagcacgctgaaaaagtggtg
atgctgaccgaagcgatcgtcggtttcccgaatttccctgcatcgattactcaagatcgt
gttgatgcggtggtgcaagtagccgaagtgggcgacccaagcaaaatcggtggggatgcc
acgcgcatgaccaccaacccacgcgagctgttgatcgccaaacgcgctgcggaagtcatt
gagcattctggctatttctatgatggtttttcaatgcagactggttcgggcggtgcatcg
ctcgcggttgcgcgctttttgaaagagaagatgctgcgccaagacatccgtgcttctttc
gctctcggtggtatcaccgcaaccatggtcgatatgcatgagcaggggctgattgattac
ttgctcgatgtgcagtgtttcgattcggtggcggcgggctcgttagcgcgcaatccgcat
catctcgaaatctctgctaacgaatacgccaacccaagctcgaaaggggcggcggtggat
aggctggatgtggttatcttgagtgcgctggagattgatacccagtttaacgttaacgtg
atcaccggctctgatggggtaattcgcggtgcatccggcggccactgcgacacggcggct
gcggcaaacttatcgattattgtggcgcctttggtgcgtggccgcattccgaccgtggtc
gagaaggtcactaacgtcatcaccccaggatccaccattgatgtgttggtgacggatcaa
ggtatcgcggtaaacccgaatcgtcccgaactgaaagcacgtttcatcgaggcgcaactg
cccgttgtcgagattgaagcgttgcaacagcgtgccgagttgctgacgggcaaaccccag
ccgttgcaatttgaagacaaaaccgttgcctttgttcactaccgtgacggttcgatcatt
gatgttatcaaacaggtaaaaagcctatga

DBGET integrated database retrieval system