KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_I0559Help
Entry
Vch1786_I0559     CDS       T01650                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:vce00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Vch1786_I0559 (recR)
DNA repair and recombination proteins [BR:vce03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Vch1786_I0559 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:602178..602780
Genome map
AA seq 200 aa AA seqDB search
MRTSHMLEHLMEALRCLPGVGPKSAQRMAFHLLQRDRKGGLQLAEALSQAMVEIGHCQEC
RTFTEQDVCHICSNPKRKENGQLCVVESPADIAALEATGQFSGRYFVLMGHLSPLDGIGP
SDIGLDTLDYRLQRGDISEVILATNPTVEGEATAQYIAELCREHQVTASRIAHGVPVGGE
LELVDGTTLSHSLLGRHKLF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaccagtcacatgctggaacatttgatggaagcattacgctgcctgccgggcgtt
ggcccaaaatcagcgcagcgtatggcattccatctgttacagcgcgatcgtaaaggtggt
ttacaactggctgaggcactgagtcaggcgatggtcgaaatcggccattgccaggaatgc
cgaacttttactgagcaggatgtttgccacatctgtagcaacccaaaacgtaaagaaaat
ggtcagttgtgtgtggttgaaagcccagcagatattgcggcgctagaagctaccggtcaa
ttttctggtcgctattttgtgttgatggggcacttatcaccgctggatggtattggcccg
agcgatattggcctcgatacgctggattatcgcttgcaacgcggtgatatcagtgaggtg
atcctcgccactaacccgacggtggaaggtgaggcgaccgcgcaatacattgccgagttg
tgtcgtgagcatcaagtcaccgcaagccgcattgcacatggtgttcccgtgggcggcgaa
cttgagttggtggatggcacgaccttatcccattcgctgttgggccgtcacaaactgttt
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system