KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_I0559Help
Entry
Vch1786_I0559     CDS       T01650                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:vce03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:602178..602780
Genome map
AA seq 200 aa AA seqDB search
MRTSHMLEHLMEALRCLPGVGPKSAQRMAFHLLQRDRKGGLQLAEALSQAMVEIGHCQEC
RTFTEQDVCHICSNPKRKENGQLCVVESPADIAALEATGQFSGRYFVLMGHLSPLDGIGP
SDIGLDTLDYRLQRGDISEVILATNPTVEGEATAQYIAELCREHQVTASRIAHGVPVGGE
LELVDGTTLSHSLLGRHKLF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaccagtcacatgctggaacatttgatggaagcattacgctgcctgccgggcgtt
ggcccaaaatcagcgcagcgtatggcattccatctgttacagcgcgatcgtaaaggtggt
ttacaactggctgaggcactgagtcaggcgatggtcgaaatcggccattgccaggaatgc
cgaacttttactgagcaggatgtttgccacatctgtagcaacccaaaacgtaaagaaaat
ggtcagttgtgtgtggttgaaagcccagcagatattgcggcgctagaagctaccggtcaa
ttttctggtcgctattttgtgttgatggggcacttatcaccgctggatggtattggcccg
agcgatattggcctcgatacgctggattatcgcttgcaacgcggtgatatcagtgaggtg
atcctcgccactaacccgacggtggaaggtgaggcgaccgcgcaatacattgccgagttg
tgtcgtgagcatcaagtcaccgcaagccgcattgcacatggtgttcccgtgggcggcgaa
cttgagttggtggatggcacgaccttatcccattcgctgttgggccgtcacaaactgttt
taa

DBGET integrated database retrieval system