KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_I0637Help
Entry
Vch1786_I0637     CDS       T01650                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:vce01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:vce00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:679175..680470
Genome map
AA seq 431 aa AA seqDB search
MRTVVWQSLSEAQQESILERPAITEGANITAAVAQVIAKVRSEGDAALFELTEKFDRVKP
ASLRVSREEMDAAAARLSETMKQALEQAYNNISKFHKAQKAQPIKVETMPGVVCEQVTRP
INKVGLYIPGGSAPLPSTVLMLGVPAQIAGCRKVVLCSPPPIADEILYVAKLCNIDEVYN
LGGGQAIAAMAYGTETVTKVDKIFGPGNAYVTEAKRQVSNDFRGAAIDMPAGPSEVLVIA
DETADANFIAADLLSQAEHGPDSQVVLVTPSPVLADQVTDAVQKQLKVLSRASIAEKALA
SSLIIIAESLTQAVSISNYYGPEHLIVQTRNPRELVPLLDNAGSIFLGDWSPESVGDYAS
GTNHVLPTYGYTRTYSSLGLADFSKRMTVQELTADGLQLLAPTVVTMAEAEGLDAHKRAV
TIRVEKLQKAQ
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagaaccgtggtttggcaatcgttgagtgaagctcagcaagaatcgattttagaacgt
cctgcgattaccgaaggagcaaacatcactgccgcagttgcgcaggtgattgcgaaagtg
cgcagtgagggtgatgccgcactgtttgaattaactgaaaaatttgatcgtgtaaaaccc
gcttcactgcgcgtatctcgcgaagagatggatgccgcggccgcgcgtttgtcggaaaca
atgaaacaggcgttggagcaggcatacaacaacatcagcaaattccacaaggcgcaaaaa
gcgcaaccaatcaaagtggaaaccatgcccggagtggtgtgtgagcaagtcactcgtccg
atcaacaaagtgggtctgtatattccgggtggcagcgcaccgctaccatcaaccgtacta
atgctcggtgtgcctgcgcaaatcgctggttgtcgtaaagtggtgctctgctcacctccg
ccaattgctgatgaaattctctacgtcgctaagctgtgtaacatcgatgaggtgtacaac
ctaggcggcggtcaggcaatcgccgcaatggcttacggtacggaaacggtgactaaagtt
gacaaaatctttggccccggtaacgcctatgtgacggaagcaaaacgccaagtgagtaac
gatttccgtggcgcagcgattgatatgcctgcaggaccttcagaagtattggtgattgct
gatgaaacggcggatgccaattttatcgccgccgatctactcagtcaggcagagcacggc
ccagattcacaggtggttctggtcacaccatcaccagtgttggccgatcaagtgacggac
gcagtgcaaaagcagcttaaagtgctttcgcgcgccagcattgctgaaaaagccttggct
tccagtctgatcattattgctgaatcactcacccaagcagtgtcgatttctaactactac
ggccctgagcacttgattgtgcagacgcgcaacccgcgtgagttggttccactgctcgat
aacgcaggctccattttccttggcgattggtcgccagaatcggtaggcgattacgcttct
ggtaccaaccatgtgctacccacttacggttacacccgcacctattccagcttaggtttg
gccgatttcagtaaacgcatgacagtgcaagagctgaccgctgatggcttgcaattgctt
gcgcccaccgtagtaacgatggcggaagcggaagggttagacgcgcacaaacgtgcggtt
acgattcgagtagaaaaattacagaaggctcaataa

DBGET integrated database retrieval system