KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_I0674Help
Entry
Vch1786_I0674     CDS       T01650                                 

Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
vce00260  Glycine, serine and threonine metabolism
vce00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vce01100  Metabolic pathways
vce01110  Biosynthesis of secondary metabolites
vce01130  Biosynthesis of antibiotics
vce01230  Biosynthesis of amino acids
Module
vce_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vce00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Vch1786_I0674
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Vch1786_I0674
Enzymes [BR:vce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Vch1786_I0674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AET26282
Position
1:complement(720049..721239)
Genome map
AA seq 396 aa AA seqDB search
MAKLNAYFGEFGGQFVPQILVPALDQLEQAFIDAQQDDAFRAEFMSLLQEYAGRPTALTL
TQNITKGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKHEIIAETGAGQHGVATAL
ACALLGLKCRVYMGAKDVERQSPNVFRMRLMGATVIPVHSGSATLKDACNEALRDWSASY
ETAHYLLGTAAGPHPFPTIVREFQRIIGEETKNQILAREGRLPDAVIACVGGGSNAIGMF
ADFIEEESVRLIGIEPAGKGIHTHQHGAPLKHGKTGIFFGMKAPLMQDEHGQVEESYSVS
AGLDFPSVGPQHAYLNAIGRAEYESITDDEALDAFQALARNEGIIPALESSHALAHAIKM
AYAEPDKEQLLVVNLSGRGDKDIFTVHKLLEDKGAL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattaaacgcctattttggcgaattcggtgggcagtttgtgccacaaattttg
gttccggcactcgatcaactggaacaagcttttattgatgcccagcaggatgatgctttt
cgcgctgaatttatgagcctactgcaagagtacgcgggtcgccccactgcgctgacactc
acgcaaaacatcaccaaaggcaccaaaaccaaactctatttgaagcgtgaagatctactg
cacggcggcgcgcacaaaaccaaccaagttttgggccaagccctgctcgccaaacgtatg
ggcaaacatgaaattatcgccgagacaggcgcaggtcaacacggtgtcgcaaccgcatta
gcctgtgcactgcttggcctaaaatgccgcgtgtacatgggtgcaaaagacgttgagcgc
caaagcccaaacgtgttccgtatgcgcttaatgggtgccaccgtgatccctgttcattca
ggttcagcaacgctaaaagatgcctgtaacgaagcgctgcgtgactggtcagccagctat
gaaactgcgcattatctgctcggtactgcggcaggccctcacccattcccaaccatagtg
cgtgaattccaacgcattattggtgaagaaaccaaaaaccaaatccttgctcgtgaaggt
cgtttgcccgatgcggtgatcgcttgtgtcggtggcggctcaaacgcgattggtatgttt
gccgatttcatcgaagaagaatccgtacgtttgatcggtattgagccagcaggtaaaggc
attcatacccatcaacatggtgcaccactcaaacacggtaaaactggtatcttcttcggc
atgaaagcaccgttgatgcaagatgaacatggtcaagtggaagagtcttactctgtctct
gcggggctggatttcccatcggtgggtccacaacatgcttacctcaacgccattggtcgt
gcggaatatgaaagcattaccgatgatgaagcactcgatgcgttccaagcgttggcacgt
aacgaaggcatcattccagcgctggagtcttcacacgctctcgcgcatgcaatcaaaatg
gcgtatgccgaaccagacaaagagcagttgctcgtggttaacctttcgggccgaggtgat
aaggatattttcaccgtacacaaattacttgaagacaaaggagcgttgtaa

DBGET integrated database retrieval system