KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_I0760Help
Entry
Vch1786_I0760     CDS       T01650                                 

Definition
ribonucleoside-diphosphate reductase alpha chain
Orthology
K00525  
ribonucleoside-diphosphate reductase alpha chain [EC:1.17.4.1]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:vce00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:vce00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(803378..805663)
Genome map
AA seq 761 aa AA seqDB search
MNQQLTVTKRDGRKENIDLDKIHRVITWAAEGLQNVSVSQVELRAHIQFYDGITTSDIHE
TIIKSAADLISEETPDYQYLAARLAVFHLRKKAYGQYEPPTLLAHVTKMVEKGKYDKHLL
EDYTREELELMDQFIDHRRDLDFSYAAVKQLEGKYFVQNRVTGQIYESAQFLYILVAACL
FAKYPKETRLDYIKRFYDATSTFKISLPTPIMSGVRTPTRQFSSCVLIECGDSLDSINAT
ASSIVRYVSQRAGIGINAGRIRALGSEIRGGEAFHTGCIPFYKYFQTAVKCCSQGGVRGG
AATVFYPLWHGEAESLLVLKNNRGVEENRVRHMDYGVQLNKLMYKRLVEGGNITLFSPSD
VPGLYDAFFQDQDEFERLYVKYENDPSIKKKTVKALEIFTLLMQERASTGRIYIQNVDHC
NTHSPFDAAVAPVRQSNLCLEIALPTSPLANVEDESGEIALCTLSAFNLGAIESLDDFEE
LSDLVVRALDALLDYQDYPLPAARRSSMNRRTLGVGVINYAYYLAKNGVKYSDGSANGLT
HRTFEAMQYHLLRASMKLAKEQGRCPLFHETNYAKGLMPIDTYKKDIDLVCAEPLHYDWD
KLRHEIMEHGLRNSTLTALMPSETSSQISNATNGIEPPRGYVSVKASKDGILKQVVPEFT
RLKENYELLWNIGSNDGYLHLVGIMQKFVDQAISANTNYDPSNFDSGKVPMKKLLQDLLT
AYKFGVKTLYYHNTRDGAKDEQTDATVKVQEDDCASGACKI
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaacaacttactgtcaccaagcgtgatggccgcaaagaaaacattgatctggat
aagatccaccgagtgatcacttgggctgccgaaggtctgcaaaacgtatctgtctcacaa
gtagaactgcgcgctcacattcagttctatgacggcattacgacttcagacattcatgaa
accatcattaagtcagcagcggatttgatctcagaagagacccccgactaccaatacctt
gctgcgcgtcttgcggttttccacctgcgcaaaaaggcctacggtcaatacgagccacct
acactgctcgctcatgtcaccaagatggttgagaaaggcaaatacgacaagcatttgctc
gaagactatacccgtgaagagctggagctgatggatcagttcattgatcaccgtcgtgac
cttgatttctcttacgctgcagtgaaacagcttgaaggcaaatatttcgtacaaaaccgt
gttaccggccaaatctacgaaagtgcacagttcctctatattctggttgcggcttgcctg
tttgcgaagtatcccaaagagacgcgccttgattacatcaagcgtttctacgatgcgacg
tcgacctttaagatctcgctacctacaccgattatgtcgggtgtacgtactcctactcgt
cagttcagctcttgtgtactgattgaatgtggtgacagccttgattctatcaatgcaacg
gcaagctcgattgttcgctacgtttctcaacgtgccggtattggtatcaacgcaggccgc
attcgtgcgctgggttcggaaatccgtggtggtgaagcgttccacactggctgtatcccc
ttctacaaatacttccaaaccgcagtgaaatgctgctcgcaaggtggtgttcgtggtggt
gcagcaaccgtattctaccctctgtggcatggtgaagcggaatctctgctggttctgaag
aacaaccgtggtgtagaagagaaccgtgttcgtcatatggattacggtgttcagctcaac
aaactgatgtacaagcgtctggttgaaggtggcaacattaccctgttctctccttctgat
gtgccgggactgtacgacgctttcttccaagatcaggatgagttcgaacgcctgtacgtg
aagtacgaaaacgatccttcaattaagaagaaaaccgttaaagcgctggaaatctttact
ctgctgatgcaagagcgtgcttcaacaggccgtatctacatccaaaacgttgaccactgt
aacacgcacagcccatttgatgcggcggttgcacctgtgcgtcaatcaaacctgtgtctg
gaaatcgcgctaccgacttcgccactggcgaatgtggaagatgaaagcggtgaaattgct
ctgtgtaccctctctgcgtttaacttaggcgcgattgagtcactggatgattttgaagag
ctgtctgaccttgtggttcgtgctctagatgcattattggattaccaagactacccactg
cctgcggcacgtcgttcttcaatgaaccgccgtactctgggtgtgggtgtgatcaactac
gcttactacctagcgaaaaacggtgtgaaatactctgacggcagcgcaaatggcctgacg
caccgcacgtttgaagccatgcagtatcacttgctgcgcgcttctatgaagctggcgaaa
gaacaaggtcgttgcccactgttccatgagaccaactacgcgaaaggcttgatgccaatc
gatacttataagaaagatatcgatctggtgtgtgcagagcctctgcattacgactgggat
aagctgcgtcacgagatcatggaacacggtctgcgtaactctacgctgacggcactgatg
ccttctgagacttcatcgcaaatctctaacgcgaccaacggtattgagccaccacgtggt
tacgtctcggtcaaagcctcaaaagacggtatcttgaaacaagtggttccagaattcact
cgcttaaaagagaactatgaactgctgtggaacatcggctcaaacgatggctatctgcac
ttagtgggtatcatgcaaaagttcgttgaccaagcgatctctgccaatactaactacgat
ccaagcaatttcgattctggcaaagtaccgatgaaaaaactgctccaagatctgctgaca
gcgtataagtttggtgtgaaaaccttgtactaccataacactcgtgatggcgcgaaagac
gagcagaccgatgctacggtgaaagtgcaggaagacgattgtgccagcggcgcttgtaag
atctaa

DBGET integrated database retrieval system