KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_I0953Help
Entry
Vch1786_I0953     CDS       T01650                                 

Gene name
ctxA
Definition
cholera enterotoxin, A subunit
Orthology
K10928  
cholera enterotoxin subunit A [EC:2.4.2.36]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Brite
Enzymes [BR:vce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.36  NAD+---diphthamide ADP-ribosyltransferase
     Vch1786_I0953 (ctxA)
Bacterial toxins [BR:vce02042]
 Type III toxins: Intracellular toxins
  ADP-ribosyltransferase
   Cholera toxin/Heat-labile enterotoxin
    Vch1786_I0953 (ctxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1:complement(1041609..1042466)
Genome map
AA seq 285 aa AA seqDB search
MISNNTNLFTYLIVLINYFSVKQREHYMVKIIFVFFIFLSSFSYANDDKLYRADSRPPDE
IKQSGGLMPRGQSEYFDRGTQMNINLYDHARGTQTGFVRHDDGYVSTSISLRSAHLVGQT
ILSGHSTYYIYVIATAPNMFNVNDVLGAYSPHPDEQEVSALGGIPYSQIYGWYRVHFGVL
DEQLHRNRGYRDRYYSNLDIAPAADGYGLAGFPPEHRAWREEPWIHHAPPGCGNAPRSSM
SNTCDEKTQSLGVKFLDEYQSKVKRQIFSGYQSDIDTHNRIKDEL
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
ttgatttcaaataatacaaatttatttacttatttaattgttttgatcaattatttttct
gttaaacaaagggagcattatatggtaaagataatatttgtgttttttattttcttatca
tcattttcatatgcaaatgatgataagttatatcgggcagattctagacctcctgatgaa
ataaagcagtcaggtggtcttatgccaagaggacagagtgagtactttgaccgaggtact
caaatgaatatcaacctttatgatcatgcaagaggaactcagacgggatttgttaggcac
gatgatggatatgtttccacctcaattagtttgagaagtgcccacttagtgggtcaaact
atattgtctggtcattctacttattatatatatgttatagccactgcacccaacatgttt
aacgttaatgatgtattaggggcatacagtcctcatccagatgaacaagaagtttctgct
ttaggtgggattccatactcccaaatatatggatggtatcgagttcattttggggtgctt
gatgaacaattacatcgtaataggggctacagagatagatattacagtaacttagatatt
gctccagcagcagatggttatggattggcaggtttccctccggagcatagagcttggagg
gaagagccgtggattcatcatgcaccgccgggttgtgggaatgctccaagatcatcgatg
agtaatacttgcgatgaaaaaacccaaagtctaggtgtaaaattccttgacgaataccaa
tctaaagttaaaagacaaatattttcaggctatcaatctgatattgatacacataataga
attaaggatgaattatga

DBGET integrated database retrieval system