KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_I1091Help
Entry
Vch1786_I1091     CDS       T01650                                 

Gene name
galM
Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:vce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Vch1786_I1091 (galM)
   00052 Galactose metabolism
    Vch1786_I1091 (galM)
Enzymes [BR:vce01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Vch1786_I1091 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1179385..1180437)
Genome map
AA seq 350 aa AA seqDB search
MNALFTSMTAQVAYDGQPAKLIELTNRRGMRVVVMDIGATWLSCTLPMGDESREVLLGVS
SMDDFVRQGSYLGATVGRYANRIARGELKIGTQTYALSVNQAGNTLHGGVVGFDRRRWQI
TQQSAQHVTFQLLSADGEQGFPGNLHVAVTYRLDEQGGVNIDYQATTDRATAVNLTNHAY
FNLNGAEQGSDCLNHQLWIDAKQFLPTDASGIPLGELQSVLGSGFDFTQPKRVGEDLLQD
KQQIRAKGYDHSYFFAPERDMHTPIAKVWSADEKVQLLVSTDKPAMQLYTGNWLAGTPNR
LGSHYKDYAGLALETQFLPDSPHHPEWLQPSCILQPGEVYRYQTRYQFVF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgttattcaccagcatgacagcacaggtcgcctatgatggtcagcctgccaag
cttattgagctcactaaccgccgcggtatgcgtgtggtagtgatggacatcggtgccact
tggctcagttgcactctaccgatgggcgatgaatcaagagaagtgctacttggcgtaagc
agcatggatgattttgtgcgccaaggcagttatttaggcgcaacggtggggcgttatgcc
aatcggattgcgcgtggcgaactcaagatagggacacaaacgtatgctttgtcggtcaat
caagctggcaatacgttacacggtggcgttgtagggtttgatcgtcgtcgctggcaaatc
acgcagcaaagcgcacagcatgtgacctttcaactgctttctgctgacggagaacaaggc
tttccgggcaacctccacgttgcagtgacctaccggttggatgagcaaggtggggtgaat
atcgactaccaagccaccaccgatcgtgcgaccgccgtgaatctaacgaaccacgcctac
tttaatttgaatggcgctgagcaaggtagtgattgcctcaatcatcagctctggattgat
gcaaagcagttcttaccaacggatgcctcgggtatcccgctcggggagttgcaatcggta
ctgggtagcggttttgatttcactcaaccgaaaagggttggggaggatttgcttcaagat
aaacagcaaatccgtgcgaaaggctatgaccacagttatttctttgcgccagagcgagat
atgcacacgcctatcgctaaggtgtggtctgccgatgagaaagtgcaactgctcgtcagt
acggataaacctgctatgcagctttataccggtaattggttggcgggaacacccaatcgc
cttggttcgcactacaaggattacgctggcctcgctttagaaacgcagtttttacccgat
tcccctcatcatccagaatggctgcaaccgagctgcatcctgcaacccggagaagtctat
cgctatcaaacgcgctatcagtttgttttttaa

DBGET integrated database retrieval system