KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_I1469Help
Entry
Vch1786_I1469     CDS       T01650                                 

Definition
aminotransferase AlaT
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vce00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Vch1786_I1469
   01230 Biosynthesis of amino acids
    Vch1786_I1469
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Vch1786_I1469
   00290 Valine, leucine and isoleucine biosynthesis
    Vch1786_I1469
Enzymes [BR:vce01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Vch1786_I1469
    2.6.1.66  valine---pyruvate transaminase
     Vch1786_I1469
Amino acid related enzymes [BR:vce01007]
 Aminotransferase (transaminase)
  Class I
   Vch1786_I1469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1600654..1601868
Genome map
AA seq 404 aa AA seqDB search
MQNIGMSSKLDNVCYDIRGPVLKHAKRMEEEGHKILKLNIGNPAPFGFDAPDEILVDVIR
NLPTSQGYCDSKGIYSARKAVVQYYQKKGIRSLDVEDVYIGNGASELIVMAMQALLNNGD
EMLVPAPDYPLWTAAVALSGGKAVHYICDEEADWYPDLDDIRSKITPKTRGIVLINPNNP
TGAVYSRDFLLEIIEIARKHKLMIFADEIYDKVLYDGAVHTSIATLADDVLVVTFNGLSK
AYRVCGFRGGWMFLTGPKQQAQGYIAGLDMLASMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLLEQRDRAWELINQIPGISCVKPKGAMYLFPKIDTKMYPIKDDQKMVLDFLVQEK
VLLVQGSGFNWPKPDHFRIVTLPHVEDLEIAISRFERFITTYSQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatatcgggatgtcgtcaaaactcgataatgtctgctatgacattcgaggacca
gtgcttaaacatgctaaacgcatggaagaagaagggcataaaatactgaagcttaacatc
ggtaaccctgccccgtttggtttcgacgccccagacgagatcctagtcgatgtgatccgt
aacctacctacttcacaaggttactgtgactcgaaaggcatttattccgctcgtaaagcg
gtggtgcagtactaccagaaaaaaggtatccgcagtctggacgtcgaagatgtgtacatc
ggcaacggtgcatcagagcttatcgtgatggcgatgcaagccctgctcaacaatggcgat
gaaatgctggtacctgcccctgattacccactgtggacagccgcggtagcactttctggc
ggcaaagccgtgcactacatctgtgatgaagaagccgattggtatcctgacctcgacgat
attcgcagcaaaatcaccccgaaaacccgtggcattgtgctgatcaaccccaataaccca
accggtgcggtttacagtcgtgatttcttgctggaaatcatcgagattgctcgcaagcac
aagctgatgattttcgccgatgagatttacgacaaagtgctgtacgacggcgcggtgcat
acctcaatcgccaccttagcggatgatgtattagtcgtcaccttcaacggcttatccaaa
gcttaccgtgtttgtggtttccgtggtggctggatgttcctgactggccccaaacagcaa
gcacaaggctatattgcagggctcgatatgctggcctcgatgcgcttgtgtgccaacgtg
ccaatgcaacatgccattcaaaccgcactcggcggctatcaaagtatcaatgagctgatt
ttgccgggcggccgactgctggaacagcgtgatcgcgcatgggagctgattaaccagatc
ccggggatttcttgcgtgaagccaaaaggcgcgatgtacctgttcccgaaaattgatacc
aaaatgtatccgatcaaagatgaccagaaaatggtgcttgatttcctagtgcaagaaaaa
gtgctgctagtacaaggcagcggctttaactggccaaaaccggatcacttccgcattgtg
actctgcctcatgtggaagatctggaaatcgccatcagtcgctttgaacgctttatcacg
acttacagccaataa

DBGET integrated database retrieval system