KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_I1492Help
Entry
Vch1786_I1492     CDS       T01650                                 

Definition
glucose-6-phosphate 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vce00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1624812..1625702
Genome map
AA seq 296 aa AA seqDB search
MDLLSLKTVTTLSDCVTIAEQDQVKIVRVIHDKASAAISLHGGHVLSFQPKGQADLLWMS
SQAIYDGKAALRGGIPVCWPWFGRIAAPAHGFARNQEWKLIEHRENEQGVIVTLGLQATP
ESLAIWPYQFDVRLHVEIRESLTVTLDVTNTDSKAWTFSGALHTYLHVGDIRETQTSGVG
TEYIDSLQNSRLCTQHGLLTLTDTIDRVYTQPEPLITVQDPALARTLTVENQGHNSAVLW
NPWQQGAQSMADMNDEGYLHFLCVESTLHAPSLAEGITLQPGQNHQLVTQITSQAQ
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggatttactctctttgaaaaccgtcacaacattatctgattgcgtcaccatagctgag
caagatcaagtcaaaatcgtacgcgtcattcatgacaaagccagcgccgctatctcacta
cacggtggccatgtcctctcctttcagccaaaaggtcaagctgacttgctgtggatgagc
tcacaagctatttacgatggcaaagccgcactacgcggtggtattccggtttgctggcca
tggtttggtcgtattgccgccccggcacatggttttgcacggaaccaagaatggaaactg
atcgaacacagggaaaatgagcaaggcgttatcgtcactctcggcttgcaagccacgcca
gagagcttagccatttggccatatcaatttgacgttcgattgcacgtggaaatccgtgag
agcttgactgtgacacttgatgtgactaacacggattcaaaagcatggaccttctctggg
gctctgcacacttatctgcacgtgggtgatattcgtgaaacgcaaacctcaggtgtggga
acggagtatattgatagcctacaaaacagtcgtctatgtactcagcacggtttgctcact
ctcactgacacgatagaccgtgtttacacgcaacccgaacccttgatcacagtgcaagac
cccgcattagctcgcacgctaaccgttgaaaatcaaggtcataactccgcggtgttgtgg
aatccttggcaacaaggtgctcaatcgatggccgacatgaatgatgagggttacttacac
tttttgtgtgtggaatcaacactgcatgcgccgtctttggcagagggtatcaccttacag
ccggggcaaaatcatcagctagtcactcaaatcactagccaagctcaatag

DBGET integrated database retrieval system