KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_I1579Help
Entry
Vch1786_I1579     CDS       T01650                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:vce01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:vce00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:vce00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1716812..1718026)
Genome map
AA seq 404 aa AA seqDB search
MTIEILVPDLPESVADATVATWHKKPGDMVARDEVIVEIETDKVVLEVPAPDAGVLEAIL
EQEGATVLSKQLLARLKPGAVAGEPTQDTPDATEPSPDKRHKASLTEESNDALSPAVRRL
LAEHNLEANQVKGSGVGGRITREDIEAHLAANKAKPAAKAEAPIAALAPVVGRSEKRVPM
TRLRKRIAERLLEAKNNTAMLTTFNEVNMKPIMDMRKQYQDVFEKRHGIRLGFMSFYVKA
VTEALKRYPEVNASIDGDDLVYHNYFDVSIAVSTPRGLVTPVLKNCDTLSLAQIEKGIKE
LAEKGRDGKLTVDELTGGNFTITNGGVFGSLMSTPIINPPQAAILGMHKIQDRAMVVDGK
IEILPMMYLALSYDHRSIDGRESVGFLVTVKELLEDPARLLLDV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgaaattctggttccagatttgcctgaatcagttgcggatgccacggttgcg
acgtggcataaaaagccgggtgacatggttgctcgcgatgaagtgatcgttgaaattgaa
actgacaaagtggtgctggaagttccagcacccgatgccggtgttctggaagctattttg
gaacaagaaggtgcgacagtgctttctaaacaactgctggcacgtttgaagccaggcgct
gtagcgggtgaaccaacccaagatactccagatgctactgagccatcaccagataaacgc
cataaagcatcactaactgaagaaagcaatgatgcgctaagccctgcggttcgtcgcctg
cttgctgaacataacttggaagcaaaccaagttaaaggttctggtgtgggtggtcgtatt
acccgcgaagacatcgaagctcacttagccgcgaacaaagccaaaccagctgcgaaagct
gaagcccctatcgcagcgctggctcctgtcgtcggccgcagtgaaaagcgcgtgccaatg
acacgtctgcgtaagcgtatcgctgagcgtctgttggaagcgaaaaataacacggctatg
ctgacgacgtttaatgaagtgaacatgaaacctatcatggacatgcgtaagcaataccaa
gatgtgttcgaaaaacgtcatggcattcgtctgggctttatgtcgttctacgtgaaagct
gtcactgaagcgctgaagcgttacccagaagtgaacgcgtctatcgatggtgatgatctg
gtttaccacaactactttgatgtgagcattgccgtatcaaccccacgtggtctggttact
ccagtactgaaaaactgcgataccttgagtttggcgcaaattgaaaaaggcatcaaagag
ctagcagaaaaaggtcgtgacggtaaattgaccgtagacgaactgactggcggtaacttt
accatcaccaacggtggtgtgtttggttcactgatgtcaacgcctatcattaacccgcca
caagcggcgattctgggtatgcataagatccaagaccgcgccatggtggtggatggcaag
attgaaatcctgccaatgatgtatctagcgctgtcttatgaccaccgttcaatcgatggt
cgtgagtcggttggtttcctagtgaccgttaaagagttgctagaagatccagcccgtctg
ctgctcgatgtttaa

DBGET integrated database retrieval system