KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_I1670Help
Entry
Vch1786_I1670     CDS       T01650                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:vce00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1798309..1799196
Genome map
AA seq 295 aa AA seqDB search
MDAAPMIHGTTVWPSPAKLNLFLYITGRRANGYHDLQTLFQFLDHGDELTITANNSGNIT
LSPALADVALEDNLIYKAAMALKNAAQSPLGADIQLHKVLPMGGGIGGGSSNAATTLVAL
NYLWQTGLSDDQLAEIGLALGADVPVFTRGFAAFAEGVGEELSAVEPEEKWYLVVRPAVS
IATKDIFTHPQLMRNTPKRDLASLLTTPYENDCEKIVRSLYPEVDKQLSWLLQYAPSRLT
GTGSCVFAEFSSRKDAQAVFAQLSDNVLAFVAQGRNVSPLRKTLADYQSAKIRPY
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggacgctgctcccatgatccacggcacaaccgtgtggccttcaccggccaaactcaac
ctgttcctttacatcacaggtcgtcgagctaacggctatcacgatctgcagaccttgttt
cagtttctcgatcacggtgatgagttaaccattaccgccaacaacagcggcaacatcacc
ctctctcctgctctggccgatgtcgcgttagaagataacctgatttacaaagccgcgatg
gcactcaaaaatgcggcgcaatcaccactcggcgcagacattcaactgcacaaggtgttg
cctatgggcggcggaattggtggcggatcatccaatgcggccactaccttagtcgcactc
aattacttgtggcaaactgggcttagcgatgatcaattggctgaaattgggctggcactc
ggagcggatgtccctgtctttactcgtggttttgcggcttttgctgaaggagttggcgaa
gaattatccgcagtagagccagaggaaaaatggtatctcgtggttcgccctgcggtcagc
atcgcgacaaaagatattttcactcatccacagctgatgagaaacacgccaaagcgtgat
ctggcaagccttcttaccaccccgtacgaaaacgattgcgaaaaaattgtccgatcactg
taccccgaggttgataagcaactttcatggctgctacaatacgcgccgtcaagattgacc
gggacgggatcttgcgtttttgctgagttttcgagcaggaaagatgcacaggccgtcttt
gctcaattatctgacaacgtcttagcgtttgtcgcccaagggcgcaatgtttcaccgctc
agaaagacgttggctgactaccaatcagctaaaatccgaccttactaa

DBGET integrated database retrieval system