KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_I1811Help
Entry
Vch1786_I1811     CDS       T01650                                 

Gene name
recD
Definition
exodeoxyribonuclease V, 67 kDa subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:vce00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Vch1786_I1811 (recD)
Enzymes [BR:vce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Vch1786_I1811 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1936672..1938792)
Genome map
AA seq 706 aa AA seqDB search
MMFWDSEVAKRLLAQGALRPLDVQFARFIGKQAVLAGHNAAESELLSVLSAALSAELGRG
HICLPLCDAQGNRCDLAALIGLYGEASLQHSERWLAVDWQALLQASPLVGQQGEAVPLMF
DGSRLYLHRYWHYEKQLAARLTELAAPQRLSPAELANLRERLNTLFARDYLGLWQALQQK
PLSSVERIQLLNDRLDVVESDALDWPAIEAVVEKAQRAADLQALEQLIPLTHCLNWQKVA
AAVALTRRFAVISGGPGTGKTTTVTKLLAALISQSMAQGKVPEIKLIAPTGKAAARLTES
MGKAVSQLAIEPEIAAAIPSSSSTIHRLLGAIPGSAEFRHHTRNPLHLDLLVVDEASMVD
LPLMVKLVEALPKHARLILLGDKDQLASVEAGAVLGDICTFLNQGYGHEQGAQLAELTGF
ATLRQTASKTVNPVADCLCMLQKSYRFDARSGIGQLAKAINSGSPARVEAVWQQSFSDIE
HFALSGEHYQQLLQTLVQAYRPYLSLLNQPTEQFESTQQSMLTLAKSALDAFSRCRLLCA
LREGDFGVMGLNTRIERALNAHKLIKTQEEIWYHGRPIMVTRNDHGLGLYNGDIGLCMRD
RDDDQGRLKVYFELPDGSIKAVLPSRVPQHETAYAMTIHKSQGSEFDLTLLILPPDYSPI
LTRELVYTGITRAKKQLKLCCDNKVLQRAIKVKTQRASGLVARLEQ
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgatgttttgggatagcgaagtagcgaaacgtctgctggcacaaggcgcgctgcgtcct
ttggatgtgcagtttgcccgctttattggcaagcaagccgtattggcagggcacaacgct
gcagaaagtgagcttttgagtgtactgagcgcggcgctcagtgcagaacttgggcgtgga
cacatctgtctgccactgtgtgatgcacagggtaatcgttgcgatctagcggcgctgatt
ggtctttatggtgaagcgagtttgcagcacagtgaacgctggttagcggtagactggcaa
gccttactgcaagcctcgccgttggtggggcagcaaggtgaagcggtgccgttaatgttt
gatggctcaaggctctatctgcatcgctactggcattatgaaaagcaactggcggcgcga
ttgactgagttggccgcaccccaacgtttaagccctgctgaactggctaacttgcgtgaa
cgcctgaataccttatttgcccgcgactatttaggcttgtggcaagcactacaacaaaag
ccgctaagttcggtcgagcggattcaactgctgaatgatcgattggatgttgtggagtcg
gatgcgctggattggccagcgattgaagctgtagtcgaaaaagcgcagcgtgccgcggat
ttgcaagctttagagcagcttattccgcttactcactgcttaaactggcaaaaagtggcg
gccgctgtcgctcttacccgccgttttgcggtgatttccggtgggccgggaaccggcaaa
accaccacagtgaccaagcttctggcggcgctgattagccaaagcatggcgcaaggtaaa
gtgccagagatcaaattgatcgctccaaccggtaaagccgcggcacggttaaccgaatcg
atgggtaaagcggtgagtcagctggcgatagagcctgagatcgccgcggcgatcccgagc
tcttccagcaccattcaccgtttgcttggcgcgattccgggcagcgctgagtttcgtcat
catacacgtaatccactccatcttgatctgttggtggtggatgaagcgtccatggttgac
ttgcctttgatggtgaaactggtcgaagcgctacccaagcacgctcggttgattttgctc
ggcgataaagatcaattggcttcggtggaagcgggggcggtgctcggtgatatttgtacc
ttcctgaaccaaggttacggccatgagcagggcgcgcagttggctgaactgacggggttt
gccactctgcgccaaactgccagtaaaacggtaaacccggtggcggattgcttatgtatg
ctgcaaaaaagctaccgttttgatgcgcgatctggcattggtcaattggcgaaagcgatc
aacagtggatctccggcgcgcgttgaagcggtgtggcaacagtcgttcagcgatattgaa
cactttgcccttagtggtgagcattatcagcaactgctgcaaaccttagtgcaggcttat
cgtccttatctgagcttgcttaatcagccaactgagcaatttgagtcgacccaacaaagc
atgctcacacttgccaaatcagcacttgatgcgttcagtcgctgccgattgctctgtgcg
ctgcgtgaaggcgattttggagtgatggggctgaacactcgcatcgaacgggcgttgaat
gctcacaagctgattaaaacgcaagaagagatctggtatcacgggcggccgatcatggtc
acgcgtaacgatcatggtttggggttatacaatggcgatattggcttgtgtatgcgcgat
cgtgacgatgatcagggcagactgaaagtctattttgagttgccggatggcagcattaaa
gccgtgttgccgagccgagtcccgcaacatgaaaccgcgtatgcgatgaccatacataaa
tcgcaaggcagcgaatttgatttaactttgctgattttaccgccggattacagtccgatt
ctgacgcgtgagttagtttacacggggatcacaagggcgaaaaaacagctcaaattgtgt
tgcgataacaaggtattgcagcgagcaattaaagtgaaaacccaacgggcgagtggctta
gtggcaaggttggagcagtaa

DBGET integrated database retrieval system