KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_I2163Help
Entry
Vch1786_I2163     CDS       T01650                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:vce01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:vce01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vce00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:vce00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:vce00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2307411..2308184
Genome map
AA seq 257 aa AA seqDB search
MRRPVVMGNWKLNGSKAMVTDLLNGLNAELEGVEGVDVVVAPPAMYLDLAERLIKEGGNK
LILGAQNTDTHNSGAYTGDMSPAMLKDFGASHIIIGHSERRDYHKESDEFVAKKFAFLKE
NGLTPVFCIGETEAQNEAGETEAVCARQINAVIDAYGVEALNGAIIAYEPIWAIGTGKAA
TADDAQRIHASIRALIAAKDAAVAEQVIIQYGGSVKPENAASYFAQPDIDGALVGGASLD
AKGFAAIAKAAAEAKKA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgtcctgttgtgatgggtaactggaaactgaatggcagcaaagctatggtcact
gacctgctaaacggtttgaatgcagaacttgaaggtgttgaaggtgttgatgttgtcgtt
gcgccaccagcaatgtatttggatctggctgagcgcctgatcaaagaaggcggcaacaag
ctgatcctgggtgcacaaaacaccgatactcacaacagtggtgcgtacacaggtgatatg
tctcctgcgatgctgaaagatttcggtgcttcgcacatcatcatcggtcactctgagcgt
cgtgattaccacaaagaatcagatgagttcgtcgctaagaaatttgcgttcctgaaagaa
aacggcctaacgccagtcttctgtatcggtgaaactgaagcgcaaaacgaagcgggcgaa
acagaagcggtatgtgctcgccaaatcaacgcagtgatcgatgcttacggcgttgaagca
ctgaacggcgcgatcatcgcttacgaaccaatctgggcaatcggtacgggtaaagccgcg
acagcagatgatgcacagcgtatccacgcgtcaatccgtgcactgatcgctgcgaaagat
gctgcagtggctgagcaagtgatcatccagtacggcggttccgtaaaaccagaaaacgca
gcgtcttactttgcacaaccagacatcgatggtgcgctggttggcggtgcatcactggat
gcgaaaggctttgccgcgatcgccaaagccgcagcagaagcgaaaaaagcgtaa

DBGET integrated database retrieval system