KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_I2274Help
Entry
Vch1786_I2274     CDS       T01650                                 

Gene name
lypA
Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:vce00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Vch1786_I2274 (lypA)
Enzymes [BR:vce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Vch1786_I2274 (lypA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2423534..2424550
Genome map
AA seq 338 aa AA seqDB search
MNPEKNLYPYTQESSLEQALNFEIAQVWHTRSEGTYRSFDKTHIYWCSLKHPEHQKAVVI
VNGRIESAWKYQELCYDLFRQGFDVYTYDHRGQGRSERLTEDRQIGHVHEFQDYVTDLKA
LVEHFDLGHYQERFLLAHSMGGAIATRYIQTTPAHPFSALALSAPMFGVNMPWYLRPWAL
LITQIMAAVTLKPSYAPGYGPYHAKPFHLNLLTHSETRYQLFRELYEAHPELQIGGPSHR
WVWQSLMATKQCLQLTRQIKIPMLILQAGEEAIVCNRAQIRLFKKLSRTQKRAALCRIAG
ARHELLFEQDAYRNQTLDHILRFFADSTIDHKRQHHRP
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctgaaaaaaatctttatccttatacgcaagagtcgagtttggagcaagctctc
aactttgagatagctcaagtgtggcacactcgaagcgaaggaacctatcgcagttttgat
aaaacgcacatttattggtgtagtctcaagcatcctgagcatcaaaaagccgtagtgatt
gtgaatggcaggattgaatctgcgtggaaatatcaagagctgtgttatgacctattccgc
caaggttttgatgtttatacctatgatcaccgtggtcaaggacggtcagaacgtctgact
gaagatagacaaataggccatgtacatgagtttcaagattacgtgactgacttaaaagcc
ttagtcgagcatttcgatctcggtcactaccaagagcgctttttattagcccattctatg
ggtggcgcgattgctacgcgctatatccagaccactccagcgcacccctttagcgcactg
gccctgagtgctccgatgtttggcgtgaatatgccttggtatttaaggccatgggctttg
ctcatcactcaaattatggctgccgttaccctaaaacccagttacgctccgggttatggc
ccttatcacgctaaaccctttcatctcaacctgctcacccacagtgaaacccgctatcag
ttgtttcgtgaactgtatgaagcgcaccctgaactgcaaattggagggccgagtcaccgc
tgggtttggcagagcttaatggcgaccaaacagtgtttgcagttaacccgacaaatcaaa
atccccatgctgatcttacaagctggcgaagaagcgattgtgtgtaatcgggcgcaaatc
cggctcttcaaaaagctgtctcgcacccaaaaacgtgccgctttatgccgcatagcagga
gccagacatgaactgctttttgaacaagatgcctaccgaaatcagacgttagaccatatt
ttgcgttttttcgccgacagtactatcgaccataaaagacagcaccatcgaccatag

DBGET integrated database retrieval system