KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_I2289Help
Entry
Vch1786_I2289     CDS       T01650                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Vch1786_I2289 (hemD)
Enzymes [BR:vce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Vch1786_I2289 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2439507..2440274
Genome map
AA seq 255 aa AA seqDB search
MTVLVTRPDEQGAELCQLLHQQGIPALHHPLLAISASPQLAALAEDLSSFDIIIAVSQHA
VIFSDQFLQHRRICWPNNAIYLAVGQKTAHVFSKACQQSVDYPEISDSEHLLALSMLRDV
AGKKVLILRGNGGRELIYSTLVERGATVRYQEAYCRHERPFAAAECVQKWQLAKVDSLVI
TSSEQLAFFIRQFETSHLPWVQQLTLLVPSQRIATLAHQLGFHRIVVTLSAANRDLVAAL
MPEKPTGTLSNDQQQ
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgacagtactggtcactcgtcctgatgaacaaggcgcagagctgtgccagctgctgcac
cagcagggcatccccgccctgcaccatccgctactcgccatctctgccagccctcaactt
gctgcgctggcagaagatttatcttcattcgatatcatcattgccgtcagtcaacatgcc
gtcatcttcagtgaccaatttctgcaacatcgccgaatttgttggccaaataacgctatt
taccttgccgttggtcaaaaaaccgcgcatgttttcagcaaagcctgccaacaatcagta
gactatccagaaataagcgatagtgaacatctgctggcactcagtatgctgcgtgatgtc
gcaggtaagaaggtattgatcttacgtggtaatggtggtcgtgagctgatttattccacc
ttagtggaaagaggagcgactgtgcgctatcaagaagcgtattgtcggcacgagcggcca
tttgccgccgccgagtgtgtccaaaaatggcagttggcgaaggtcgactcactggtgatc
accagcagtgagcagttggctttttttatccgtcagttcgagacatcacacttgccatgg
gtgcagcagttaactttgctcgtacccagccaacggattgccactctcgcccaccaacta
ggatttcatcgcatcgtggtcacgctaagtgctgctaatcgcgatttagtcgcggcattg
atgcccgaaaaaccaacaggaactctgagcaatgaccaacaacaataa

DBGET integrated database retrieval system