KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_I2318Help
Entry
Vch1786_I2318     CDS       T01650                                 

Gene name
yhjA
Definition
cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2466632..2467633)
Genome map
AA seq 333 aa AA seqDB search
MKVVLTSLSLAISLSLAGYAFAASPRNEPVSPILPAQEIHIGKAELGKKLYFDPRLSKSG
FISCNSCHNLSMGGSDNLKTSIGHNWQQGPINSPTVLNSSLNIAQFWDGRAADLKEQAGG
PIANPGEMAFTHTLAIDVLQSIPAYVSEFRLVFGKPTLDIDQVTEAIAEFEKTLVTPYSR
FDQWLMGDDSAITAQELAGYELFKNSGCVACHNGSALGGNSFQKMGLIEPYQTNNKVEGL
SAVTGADADRFKFKVPTLRNVALTYPYFHDGEAATLKDAVDIMGRLQLGRKFTDDENGKI
VAFLHTLTGEQPSFALPILPPSNDNTPKPQPFD
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgttcttacctcgctgagcttagcgatatccctctccctcgctgggtatgct
tttgcggcatcgccaagaaacgaacctgtttcccccattttacctgcgcaggaaatccac
attggaaaagccgagttgggtaaaaaactgtactttgatccgcgcttatccaagtcaggg
tttatctcgtgtaactcatgccataacttgagcatgggcggcagtgataacttaaaaacg
tccatcggtcataactggcaacaaggtccaatcaactcaccgactgtgctcaattccagt
ttgaatatcgcccaattttgggatggtcgagcggccgatctgaaagagcaggcgggtggg
ccgattgccaatccgggtgaaatggcttttacgcatacgttagccattgatgtgttgcaa
tcaatcccagcttacgtgagtgagtttcgtctagtgtttggtaagccaaccctcgatatc
gatcaagtgactgaagcgattgcggagtttgaaaagaccttagtgaccccatactcacgt
tttgaccaatggttaatgggggatgatagcgcgataacggctcaagagctggcaggctat
gaattgtttaaaaactcgggctgcgtggcttgtcataacggcagtgcgttaggtggcaat
tcgttccaaaaaatgggtttgattgaaccgtatcaaaccaacaataaagtcgaaggactc
agtgcggtaaccggcgctgacgccgatcgctttaaatttaaagtcccgacactgcgcaat
gtggcgttaacgtatccctacttccatgacggagaagcggccacgcttaaagacgctgtg
gatatcatggggcgtttacagctagggcgtaaatttaccgatgatgaaaacggtaagata
gtggctttcttgcataccttaacaggagagcaaccaagctttgctttacccattttaccg
ccatccaacgataatacacctaagcctcagccttttgattag

DBGET integrated database retrieval system