KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_I2705Help
Entry
Vch1786_I2705     CDS       T01650                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
vce00040  Pentose and glucuronate interconversions
vce00052  Galactose metabolism
vce00500  Starch and sucrose metabolism
vce00520  Amino sugar and nucleotide sugar metabolism
vce01100  Metabolic pathways
vce01130  Biosynthesis of antibiotics
Module
vce_M00362  Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:vce00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Vch1786_I2705 (galU)
   00052 Galactose metabolism
    Vch1786_I2705 (galU)
   00500 Starch and sucrose metabolism
    Vch1786_I2705 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Vch1786_I2705 (galU)
Enzymes [BR:vce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Vch1786_I2705 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 Smr
Motif
Other DBs
NCBI-ProteinID: AET28243
Position
1:complement(2844816..2845739)
Genome map
AA seq 307 aa AA seqDB search
MVESAKNFSLAHHRAKMMIKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVDEA
IQAGITGMCIVTGRGKHSIMDHFDMNYELEHQIRGTNKEELLGDIRKIIESANFTFIRQR
EMKGLGHAILTGKELVGDEPFAVVLADDLCVNEEQGVLAQMVALYKQFRCSIVAVQEVPE
NETHKYGVIAGEMIKDDLFRVDNMVEKPEPGTAPSNLAIIGRYILTPDIFDLIEQTEPGK
GGEIQITDALLKQAKAGCVLAYKFKGKRFDCGSVEGYIEATNFCYENMYKKNDQKVELAK
KSTHKGQ
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtggtagagtcagcaaaaaatttctccctagcacaccatagagcaaaaatgatgattaag
aagtgtctatttccggcagctggctacggtacccgattcctaccagcgactaagtcgatg
cccaaagagatgatgcctgttgttaacaaaccgctgattgagtacggtgttgatgaagcg
attcaagcgggtatcacaggcatgtgtattgtgacaggtcgtggtaagcattcgatcatg
gatcactttgacatgaactacgagttagagcaccaaatccgcggtacgaataaagaagag
ctattgggtgatatccgtaaaatcatcgaaagcgctaactttacttttattcgccaacgc
gaaatgaaaggcttgggtcacgctatcttaacgggcaaagagctggtcggtgatgagccg
tttgccgttgtgctagcggacgacctgtgtgtgaacgaagagcaaggcgtactggcacag
atggttgcactgtacaaacagttccgctgctctatcgtcgctgtgcaagaggttccagaa
aacgaaactcacaaatacggcgtgatcgcaggtgagatgatcaaagacgatctgttccgc
gtcgataacatggtcgaaaaaccagagccgggcacagcgccaagcaacctcgccatcatt
ggccgttatatcctcacgccagatatttttgatctgattgagcagaccgagccgggcaaa
ggcggtgaaattcaaatcactgacgcgctgctcaaacaagccaaagcgggttgtgtactg
gcttataaattcaaaggtaagcgcttcgactgtggtagcgttgaaggctatatcgaagcc
accaacttctgctacgaaaacatgtacaagaaaaacgaccaaaaagtggagttggctaaa
aagtcgacgcacaaaggtcagtaa

DBGET integrated database retrieval system