KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_I2750Help
Entry
Vch1786_I2750     CDS       T01650                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vce00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:vce00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2893960..2894457
Genome map
AA seq 165 aa AA seqDB search
MMISMIAAMADQRIIGKDNQMPWHLPADFAWFKRCTLGKPVVMGRKTYQSIGRPLPGRHN
IVISRDASLQIEGVDVVTSIEAALAKAGEVDEVMIIGGGSLYAACLPMAHKLYITEIHAK
LDGDTQFPEWGSDWLERSREHYPADEKNAYGMDFVIFERQYPLPT
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgatgatcagtatgattgccgcgatggcagaccagcgcattattggtaaagataaccag
atgccttggcatctaccggctgatttcgcgtggttcaaacgctgtacattaggtaagcct
gtagtgatggggcgtaaaacctaccaatcgatcggacgtcctttaccggggcggcacaat
attgtgatctcccgtgatgcgagtttgcagattgagggggtggatgtggtgacctccatt
gaggcggcgctggcgaaagcgggtgaggtcgacgaggtgatgatcatcggaggtggtagc
ttgtatgcggcctgtttgccgatggcccataaactgtatattaccgagatccatgcaaaa
ttggatggtgatactcagtttcctgaatgggggagtgattggctagagcgctctcgtgag
cattatcctgccgatgaaaaaaatgcctacgggatggattttgtgatttttgaacgccaa
tatccccttcctacttga

DBGET integrated database retrieval system