KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_II0474Help
Entry
Vch1786_II0474    CDS       T01650                                 

Definition
acyl-CoA thioesterase I
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:vce01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:427534..428031
Genome map
AA seq 165 aa AA seqDB search
MPIEQAWPSLLAEELVEQGQTVTVVNGSISGDTTGNGLARLPSLLSQHQPDTVLIELGAN
DGLRGFPPQTVTHNLTTMIEQIQAKNAKVILMQIRIPPNYGKRYSDAFYQIYPSLAEQFS
IPLIPFFLEQVILKPEWMMADGLHPKPEAQPWIAKFVAEHLAAHL
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcctatcgaacaagcttggccaagtttactggccgaagagctagtggaacagggtcaa
accgttaccgtagttaacggaagcatttctggtgataccacaggcaacgggctcgcccgc
ctgccctctcttctgagccaacatcagcccgataccgtactgatagaattaggagccaac
gacggtttacgcggttttccaccgcaaacggtcactcataacctcaccaccatgattgaa
cagatccaagctaaaaacgcaaaagtcatcttaatgcagatccgtatcccacctaactat
ggcaaacggtacagcgatgcgttttaccagatctatcctagcctagctgagcagttttct
atcccgcttatcccgttctttcttgagcaagtgatcctcaaaccagaatggatgatggca
gatggtttacaccccaaacctgaagcgcagccttggatagccaagtttgtggccgaacac
cttgccgcacatttgtaa

DBGET integrated database retrieval system