KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_II0474Help
Entry
Vch1786_II0474    CDS       T01650                                 

Definition
acyl-CoA thioesterase I
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:vce00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Vch1786_II0474
Enzymes [BR:vce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Vch1786_II0474
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Vch1786_II0474
Lipid biosynthesis proteins [BR:vce01004]
 Fatty acid synthase
  Component type
   Vch1786_II0474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:427534..428031
Genome map
AA seq 165 aa AA seqDB search
MPIEQAWPSLLAEELVEQGQTVTVVNGSISGDTTGNGLARLPSLLSQHQPDTVLIELGAN
DGLRGFPPQTVTHNLTTMIEQIQAKNAKVILMQIRIPPNYGKRYSDAFYQIYPSLAEQFS
IPLIPFFLEQVILKPEWMMADGLHPKPEAQPWIAKFVAEHLAAHL
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcctatcgaacaagcttggccaagtttactggccgaagagctagtggaacagggtcaa
accgttaccgtagttaacggaagcatttctggtgataccacaggcaacgggctcgcccgc
ctgccctctcttctgagccaacatcagcccgataccgtactgatagaattaggagccaac
gacggtttacgcggttttccaccgcaaacggtcactcataacctcaccaccatgattgaa
cagatccaagctaaaaacgcaaaagtcatcttaatgcagatccgtatcccacctaactat
ggcaaacggtacagcgatgcgttttaccagatctatcctagcctagctgagcagttttct
atcccgcttatcccgttctttcttgagcaagtgatcctcaaaccagaatggatgatggca
gatggtttacaccccaaacctgaagcgcagccttggatagccaagtttgtggccgaacac
cttgccgcacatttgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system