KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_II0812Help
Entry
Vch1786_II0812    CDS       T01650                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:vce00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Vch1786_II0812
Enzymes [BR:vce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Vch1786_II0812
Exosome [BR:vce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Vch1786_II0812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:790030..792219
Genome map
AA seq 729 aa AA seqDB search
MKITKKPSKVQQFYDQLARAAFADPFSFLGPYIPAEQGALRVWMPGADNVALVVEGQARV
ALEREGEGGFVLKDGRNLRFTHYQLAVDWAGTEQLLDDPYQYHGLYAEYEDLHTPKQMYH
HMGAQFVTLERDGKMVSGVRFLVYAPHAAACSLIGAFNHWDGRRHPMQRLDYGIWGIFIP
GLPEGTQYKFELKGPHGEGLPHKADPWGFYAEQYPSFASVTYDHRRYQWQDTAWQQRPVT
EKRKQALSFYELHVGSWKRGENGEFLNYRELADQLVPYLVEMGYTHVELMPVAEHPFYGS
WGYQPVGLFAPTSRYGSPDDFKYFVDLCHQAGIGVVLDWVPAHFPSDSHGLANFDGTPLF
HDPDPRRGWHQDWNSYIYDLGREHVRRFLVANALYWFEMFHIDGIRVDAVASMLYLDYSR
SHDQWIPNVDGGRENYDAIATFKWMNEEVYKHFPNAMTIAEESTAFPGVSAPTFMGGLGF
GFKWNMGWMHDSLSYIKEDPVHRKYHHNTLTFPLIYAFSENYVLSLSHDEVVYGKRSLMY
KMPGDEWQQTANLRAYLGYMYGQPGKKLNFMGTELGQTAEWDHDGQLQWFLTQFERHAGI
QRLVRDLNHLYQAQTALHQLDCDPRGFEWRLQDNADLSVIAHERMDEAGNRVLVITNFTP
VPQQEFRLGVPKTGKYRLLLNTDAKQYNGSDYPVLQDVSTEAISSEGLDQSLLLSVPPLA
TLFYQWSAK
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
ttgaagatcacaaaaaaaccatccaaggttcaacaattttatgatcagttggcgcgtgca
gcctttgctgatcccttttcatttctaggcccttacattcccgctgaacaaggtgcgctg
cgagtgtggatgccgggtgctgacaacgtcgcgttggtggttgaagggcaagctcgtgtg
gcgttagagcgtgaaggcgagggcggctttgtgctgaaagatggccgtaatctgcgtttt
acgcactaccaattggctgtcgattgggcgggtaccgagcagttactcgatgatccgtat
caatatcacggcctctacgctgaatatgaagatctgcatacgccaaagcagatgtatcac
catatgggggcgcagtttgtcaccctagagcgtgatggaaaaatggtctctggcgtacgt
tttctggtgtatgcccctcacgcggcggcgtgcagtttgattggcgcgtttaaccattgg
gatggtcgtcgccatccgatgcagcgtctcgattacggtatttggggaatttttatcccc
ggcttgccggaaggcacgcaatacaaatttgagctgaaaggcccacatggagaaggtctg
ccgcataaagcggatccgtggggtttttatgctgagcaatacccttcttttgcttctgtg
acttatgatcatcgtcgttatcagtggcaagatacggcttggcagcagcgccctgtgact
gaaaagcgtaaacaagcgctctcgttttatgagctgcacgttggctcatggaagcgaggc
gaaaacggtgaattcctcaattatcgtgaattggctgatcaattggtgccttatctggtt
gagatgggttatacccatgttgagttaatgcctgtcgctgagcacccattttatggttct
tggggctatcaaccggttggtctgtttgcgcccactagccgttacggctcgccggatgat
ttcaaatattttgttgatttgtgccaccaagcggggattggtgtggtgctcgattgggtg
cctgcgcacttcccatcagattctcacggtctggccaattttgatggcacgcccttattc
catgatccggatccacgtcgcggttggcatcaagactggaactcttacatctacgatctt
ggtcgcgagcatgtgcgccgtttcttagtcgctaatgcgctgtattggtttgagatgttc
catatcgatggcattcgtgttgatgcggtcgcatcgatgctctatctcgattattcgcgt
agccatgatcaatggatcccgaatgttgacggtggacgcgaaaactacgatgcgattgct
accttcaaatggatgaacgaggaggtatacaaacacttcccgaatgcgatgacgattgcc
gaagaatcgacggctttccccggtgtttctgccccgacctttatgggcggcctcgggttt
ggttttaagtggaacatgggctggatgcacgatagcttgtcgtacatcaaagaggatccg
gtgcatcgcaaataccaccacaataccctgactttcccgctgatttacgcgtttagtgaa
aactatgtgctctctttatcacacgatgaagtggtgtatggtaagcgctcacttatgtac
aaaatgccgggtgatgagtggcagcaaaccgccaacttacgcgcctacttgggttatatg
tatggtcagccgggcaaaaaactcaactttatgggtaccgaattaggacagactgcggag
tgggatcacgatggtcagttgcagtggttcttaacgcaatttgagcgccatgccgggatc
cagcgtttggtgcgcgatttgaaccatctgtaccaagcccaaacggcgttgcatcagctt
gattgcgatccgcgcggcttcgaatggcgcttacaagataatgccgatctcagcgtgatc
gctcatgaacggatggatgaagccggtaatcgtgtgttagtgatcaccaacttcacgcct
gttccacagcaggaatttcgcttaggcgttcctaaaacagggaagtaccgcttgttgctc
aataccgatgccaagcagtacaacggcagtgattatccggtattgcaggatgtgagtacg
gaagcgatcagcagtgaaggtttggatcaatcgctgctattgagtgtgccgccgctcgcg
acgctattttatcaatggagtgcgaagtag

DBGET integrated database retrieval system