KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_II0924Help
Entry
Vch1786_II0924    CDS       T01650                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:vce00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Vch1786_II0924 (rbsK)
Enzymes [BR:vce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Vch1786_II0924 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:918547..919467
Genome map
AA seq 306 aa AA seqDB search
MNKLVVLGSVNADHVLQVPSFPRPGETLHGRNYQVIPGGKGANQAVAAARMQADVGFIAC
VGDDSFGINIRESFKLDGINTAGVKLQPNCPTGIAMIQVSDSGENSICISAEANAKLTAA
AIEPDLAAIRDARYLLMQLETPLDGILKAAQEAKTAKTNVILNPAPARELPDELLKCVDL
ITPNETEAEVLTGITVYDDSSAQQAADALHCKGIEIVIITLGSKGVWLSQNGRGQRIPGF
VVKATDTTAAGDTFNGALVTGLLQEMPLESAIKFAHAAAAISVTRFGAQTSIPTRAEVEA
FLAEHS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaataagttggtggttctgggtagcgtcaatgcagaccatgtgctgcaagtgccttca
tttcctcgccccggagaaaccctacacgggcgcaattatcaagtcattccgggcggaaaa
ggggcaaaccaagcggttgccgccgcgcgtatgcaagcggatgtaggtttcattgcctgt
gttggcgatgattcgtttggcattaatattcgtgaaagttttaagctagatggcattaat
acggcgggcgtgaagctgcaaccgaattgtccaactggtattgcgatgattcaagtttca
gacagtggtgagaacagtatctgtatttctgcagaagccaatgccaagctgacggccgct
gcgattgagcccgatcttgcggcgattcgggatgcacgttatttgctgatgcaactggaa
acaccgcttgatggcattttaaaagcagcgcaagaagccaaaacggccaaaaccaatgtg
attcttaaccctgcaccagcccgtgaactgcctgatgagttgctgaagtgtgtagatctg
attacgccgaacgaaaccgaagcggaagtgctcaccggaattacggtttatgatgattct
agcgcgcagcaagcggcggacgctttacactgtaaaggcatcgagattgtgattattacc
cttggttcaaagggtgtgtggctgagccaaaatggtcgcgggcaacgaattcccggtttt
gtggtgaaagccacggacaccaccgccgcaggtgatacctttaacggtgcattggtgact
ggcttgttgcaagaaatgcctctagaatcagccattaagtttgcccatgccgctgccgca
atttcggtaacacgctttggtgcacaaacctcgattcccactcgtgcggaagttgaggcc
tttttagcagaacactcatag

DBGET integrated database retrieval system