KEGG   Vibrio cholerae O1 biovar El Tor FJ147: IR04_02960Help
Entry
IR04_02960        CDS       T03827                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vcf  Vibrio cholerae O1 biovar El Tor FJ147
Pathway
vcf00071  Fatty acid degradation
vcf00280  Valine, leucine and isoleucine degradation
vcf00310  Lysine degradation
vcf00362  Benzoate degradation
vcf00380  Tryptophan metabolism
vcf00620  Pyruvate metabolism
vcf00630  Glyoxylate and dicarboxylate metabolism
vcf00640  Propanoate metabolism
vcf00650  Butanoate metabolism
vcf00900  Terpenoid backbone biosynthesis
vcf01100  Metabolic pathways
vcf01110  Biosynthesis of secondary metabolites
vcf01120  Microbial metabolism in diverse environments
vcf01130  Biosynthesis of antibiotics
vcf01200  Carbon metabolism
vcf01212  Fatty acid metabolism
vcf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vcf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    IR04_02960
   00630 Glyoxylate and dicarboxylate metabolism
    IR04_02960
   00640 Propanoate metabolism
    IR04_02960
   00650 Butanoate metabolism
    IR04_02960
  Lipid metabolism
   00071 Fatty acid degradation
    IR04_02960
   00072 Synthesis and degradation of ketone bodies
    IR04_02960
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IR04_02960
   00310 Lysine degradation
    IR04_02960
   00380 Tryptophan metabolism
    IR04_02960
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    IR04_02960
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    IR04_02960
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    IR04_02960
Enzymes [BR:vcf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     IR04_02960
Exosome [BR:vcf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IR04_02960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJZ98189
UniProt: A0A2L2MB78
Position
II:complement(602235..603440)
Genome map
AA seq 401 aa AA seqDB search
MEKIYIVGAKRSAIGAFGGSLKECSAGALAGQVIQAALEAAQLKPEAVDEVIVGNVVSAG
QGMGVGRQAALAAGVPQSVPAYSINMVCGSGMKSVMDAVAHIKAGDASVVVAAGVEVMSQ
IPFVTPASLRDGQKMGAFEVKDLLIHDGLTDVFNQYHMGVTAENIAKQYDIARQTQDEFA
LASQMKATAAIEAGHFKREIVPISVKKRRETVVFDTDEYPKPTTTLAALQGLRAAFDAQG
TVTAGNASGINDGASAVIIASESAVKKLGLTPIAEIMSYAQTGLDPKVMGLGPVSAVTQA
LAKAELSITQVDLFELNEAFAAQALGVVYGLAEQHAIQPEAILEKANVNGGAIALGHPLG
ASGNRILVTLLHELQRRQKHYGVASLCVGGGMGTAIVIKTV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagatctatatcgtgggcgcaaagcgctcagctatcggagcctttggtggttca
cttaaagagtgttcagcaggcgctttggcagggcaagtcatccaagccgctcttgaagcc
gcacaactcaaacctgaagctgtggatgaagtgattgttggtaacgttgtgagtgccgga
caaggcatgggtgttgggcgtcaagcggctttagcggctggtgttccacagtcggttcca
gcttacagcatcaacatggtgtgtggcagtgggatgaaatcggtgatggatgcggttgcg
cacatcaaagcgggagatgcttctgtcgttgttgccgctggtgttgaggtcatgtcacaa
atcccatttgttacgcctgccagcttacgagatgggcagaaaatgggcgcgtttgaagtg
aaagatctgctcatccatgacggtctgaccgatgtcttcaatcaataccacatgggtgtg
acggcagaaaatatcgctaaacagtacgacatcgctcgtcaaacacaagatgagtttgcg
ttggccagccaaatgaaagcgacagcggccattgaagccggacattttaagcgagaaatt
gtgcctatttcggtcaaaaaacgccgtgaaaccgtcgtgtttgatacggatgaataccct
aaaccgacgaccacgttggcagcattgcaaggcttacgcgccgcgttcgatgcacaaggt
acggttaccgcaggtaatgcttctggaattaacgatggtgccagtgcggtgattatcgcc
agtgaaagtgcggtaaaaaaactaggcttaacccctatcgcagaaattatgagttatgca
caaacagggttggatccgaaagtcatgggcttagggcctgtgagtgcagtcactcaagca
ttagcgaaagcagaattatctatcactcaggttgatctgtttgaacttaacgaagcgttt
gccgctcaagcattaggtgtcgtttacggtttagctgagcaacacgcgattcaacctgag
gcgattttagaaaaagccaacgtcaatggcggtgccattgcgttagggcatccattaggg
gcatcgggtaaccgcattctggttactctgcttcatgaattacagcgtcgccaaaaacat
tatggcgttgcttcactctgcgtcggcggtggcatgggtaccgcgatcgtgattaaaaca
gtttaa

DBGET integrated database retrieval system