KEGG   Vibrio cholerae O1 biovar El Tor FJ147: IR04_02960Help
Entry
IR04_02960        CDS       T03827                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vcf  Vibrio cholerae O1 biovar El Tor FJ147
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:vcf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    IR04_02960
   00630 Glyoxylate and dicarboxylate metabolism
    IR04_02960
   00640 Propanoate metabolism
    IR04_02960
   00650 Butanoate metabolism
    IR04_02960
  Lipid metabolism
   00071 Fatty acid degradation
    IR04_02960
   00072 Synthesis and degradation of ketone bodies
    IR04_02960
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IR04_02960
   00310 Lysine degradation
    IR04_02960
   00380 Tryptophan metabolism
    IR04_02960
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    IR04_02960
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    IR04_02960
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    IR04_02960
Enzymes [BR:vcf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     IR04_02960
Exosome [BR:vcf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IR04_02960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
II:complement(602235..603440)
Genome map
AA seq 401 aa AA seqDB search
MEKIYIVGAKRSAIGAFGGSLKECSAGALAGQVIQAALEAAQLKPEAVDEVIVGNVVSAG
QGMGVGRQAALAAGVPQSVPAYSINMVCGSGMKSVMDAVAHIKAGDASVVVAAGVEVMSQ
IPFVTPASLRDGQKMGAFEVKDLLIHDGLTDVFNQYHMGVTAENIAKQYDIARQTQDEFA
LASQMKATAAIEAGHFKREIVPISVKKRRETVVFDTDEYPKPTTTLAALQGLRAAFDAQG
TVTAGNASGINDGASAVIIASESAVKKLGLTPIAEIMSYAQTGLDPKVMGLGPVSAVTQA
LAKAELSITQVDLFELNEAFAAQALGVVYGLAEQHAIQPEAILEKANVNGGAIALGHPLG
ASGNRILVTLLHELQRRQKHYGVASLCVGGGMGTAIVIKTV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagatctatatcgtgggcgcaaagcgctcagctatcggagcctttggtggttca
cttaaagagtgttcagcaggcgctttggcagggcaagtcatccaagccgctcttgaagcc
gcacaactcaaacctgaagctgtggatgaagtgattgttggtaacgttgtgagtgccgga
caaggcatgggtgttgggcgtcaagcggctttagcggctggtgttccacagtcggttcca
gcttacagcatcaacatggtgtgtggcagtgggatgaaatcggtgatggatgcggttgcg
cacatcaaagcgggagatgcttctgtcgttgttgccgctggtgttgaggtcatgtcacaa
atcccatttgttacgcctgccagcttacgagatgggcagaaaatgggcgcgtttgaagtg
aaagatctgctcatccatgacggtctgaccgatgtcttcaatcaataccacatgggtgtg
acggcagaaaatatcgctaaacagtacgacatcgctcgtcaaacacaagatgagtttgcg
ttggccagccaaatgaaagcgacagcggccattgaagccggacattttaagcgagaaatt
gtgcctatttcggtcaaaaaacgccgtgaaaccgtcgtgtttgatacggatgaataccct
aaaccgacgaccacgttggcagcattgcaaggcttacgcgccgcgttcgatgcacaaggt
acggttaccgcaggtaatgcttctggaattaacgatggtgccagtgcggtgattatcgcc
agtgaaagtgcggtaaaaaaactaggcttaacccctatcgcagaaattatgagttatgca
caaacagggttggatccgaaagtcatgggcttagggcctgtgagtgcagtcactcaagca
ttagcgaaagcagaattatctatcactcaggttgatctgtttgaacttaacgaagcgttt
gccgctcaagcattaggtgtcgtttacggtttagctgagcaacacgcgattcaacctgag
gcgattttagaaaaagccaacgtcaatggcggtgccattgcgttagggcatccattaggg
gcatcgggtaaccgcattctggttactctgcttcatgaattacagcgtcgccaaaaacat
tatggcgttgcttcactctgcgtcggcggtggcatgggtaccgcgatcgtgattaaaaca
gtttaa

DBGET integrated database retrieval system