KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC0089Help
Entry
VC0089            CDS       T00034                                 

Definition
cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Brite
Enzymes [BR:vch01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     VC0089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:86574..87575
Genome map
AA seq 333 aa AA seqDB search
MKVVLTSLSLAISLSLAGYAFAASPRNEPVSPILPAQEIHIGKAELGKKLYFDPRLSKSG
FISCNSCHNLSMGGSDNLKTSIGHNWQQGPINSPTVLNSSLNIAQFWDGRAADLKEQAGG
PIANPGEMAFTHTLAIDVLQSIPAYVSEFRLVFGKPTLDIDQVTEAIAEFEKTLVTPYSR
FDQWLMGDDSAITAQELAGYELFKNSGCVACHNGSALGGNSFQKMGLIEPYQTNNKVEGL
SAVTGADADRFKFKVPTLRNVALTYPYFHDGEAATLKDAVDIMGRLQLGRKFTDDENGKI
VAFLHTLTGEQPSFALPILPPSNDNTPKPQPFD
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgttcttacctcgctgagcttagcgatatccctctccctcgctgggtatgct
tttgcggcatcgccaagaaacgaacctgtttcccccattttacctgcgcaggaaatccac
attggaaaagccgagttgggtaaaaaactgtactttgatccgcgcttatccaagtcaggg
tttatctcgtgtaactcatgccataacttgagcatgggcggcagtgataacttaaaaacg
tccatcggtcataactggcaacaaggtccaatcaactcaccgactgtgctcaattccagt
ttgaatatcgcccaattttgggatggtcgagcggccgatctgaaagagcaggcgggtggg
ccgattgccaatccgggtgaaatggcttttacgcatacgttagccattgatgtgttgcaa
tcaatcccagcttacgtgagtgagtttcgtctagtgtttggtaagccaaccctcgatatc
gatcaagtgactgaagcgattgcggagtttgaaaagaccttagtgaccccatactcacgt
tttgaccaatggttaatgggggatgatagcgcgataacggctcaagagctggcaggctat
gaattgtttaaaaactcgggctgcgtggcttgtcataacggcagtgcgttaggtggcaat
tcgttccaaaaaatgggtttgattgaaccgtatcaaaccaacaataaagtcgaaggactc
agtgcggtaaccggcgctgacgccgatcgctttaaatttaaagtcccgacactgcgcaat
gtggcgttaacgtatccctacttccatgacggagaagcggccacgcttaaagacgctgtg
gatatcatggggcgtttacagctagggcgtaaatttaccgatgatgaaaacggtaagata
gtggctttcttgcataccttaacaggagagcaaccaagctttgctttacccattttaccg
ccatccaacgataatacacctaagcctcagccttttgattag

DBGET integrated database retrieval system