KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC0105Help
Entry
VC0105            CDS       T00034                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VC0105
Enzymes [BR:vch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     VC0105
Exosome [BR:vch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VC0105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
I:100811..101854
Genome map
AA seq 347 aa AA seqDB search
MSVSIQGQFPGRRLRRLRKHDFSRRLVAENQLSVNDLIYPMFILMGKDRREKVDSMPGVE
RLSIDLMLEEAQYLANLGVPAIALFPVVNQDAKSLCAAEAYNPEGLVQRAVRALKEHVPQ
MGVITDVALDPFTTHGQDGIIDEQGYVLNDETTEVLVKQALSHAQAGADVVAPSDMMDGR
IGRIRQALEEAGYIHTQIMAYSAKYASNYYGPFRDAVGSSANLKGGNKKNYQMDPANSDE
ALHEVAMDINEGADMVMVKPGMPYLDVVRRVKTELQVPTFAYQVSGEYAMHKAAIMNGWL
KERETVFESLLCFKRAGADGILTYFAKEVAEWLAEDSAKAAQFLPKK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggtatccattcaaggtcaatttcctgggcgtcgtttacgccgcctgcgtaaacat
gatttcagccgtcgccttgtggccgaaaaccagttgtcggtgaacgatctgatctacccg
atgtttattttgatgggtaaagatcgccgtgaaaaagtcgattccatgccgggcgtagaa
cgtttatccatcgatttaatgctggaagaagcacagtatctcgctaacctcggtgtgcct
gcgattgctctgtttcctgtggtcaatcaggatgcaaaaagcctatgtgctgccgaagct
tacaaccctgaaggcttagttcaacgcgcagtgcgtgcgctgaaagagcatgtgccgcaa
atgggcgtgatcactgatgtggcattggatccattcacaactcatggacaagacggcatc
atcgatgagcaaggttatgtgttgaatgatgaaacaacggaagtgctagtgaagcaagca
ctgtcgcatgctcaagctggtgcggatgtggttgccccttccgatatgatggatggccgt
attgggcgcattcgtcaagcattggaagaggcggggtacattcatactcaaatcatggct
tattccgctaaatatgcctcgaattactatgggccattccgtgatgcggtcgggtcatct
gcgaatttaaaaggtggcaacaagaaaaactaccaaatggaccccgccaattccgatgaa
gctttgcatgaagtcgcgatggacatcaatgaaggtgcggacatggtgatggtgaagccc
ggcatgccctatctagatgtggtgcgccgtgtcaaaaccgagttgcaggtaccgaccttc
gcttaccaagtttccggtgagtatgcgatgcacaaagcggcaatcatgaatggttggttg
aaagagcgggaaacggtattcgaatctttactctgcttcaaacgtgcaggtgcagatggc
attttgacttactttgcgaaagaggtggctgagtggttggcggaagacagcgcaaaagcc
gcgcagttcttacctaaaaagtaa

DBGET integrated database retrieval system