KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC0105Help
Entry
VC0105            CDS       T00034                                 

Definition
(RefSeq) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
vch00860  Porphyrin and chlorophyll metabolism
vch01100  Metabolic pathways
vch01110  Biosynthesis of secondary metabolites
vch01120  Microbial metabolism in diverse environments
Module
vch_M00121  Heme biosynthesis, glutamate => heme
vch_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VC0105
Enzymes [BR:vch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     VC0105
Exosome [BR:vch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VC0105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-GeneID: 2615296
NCBI-ProteinID: NP_229764
UniProt: Q9KVN6
Position
I:100811..101854
Genome map
AA seq 347 aa AA seqDB search
MSVSIQGQFPGRRLRRLRKHDFSRRLVAENQLSVNDLIYPMFILMGKDRREKVDSMPGVE
RLSIDLMLEEAQYLANLGVPAIALFPVVNQDAKSLCAAEAYNPEGLVQRAVRALKEHVPQ
MGVITDVALDPFTTHGQDGIIDEQGYVLNDETTEVLVKQALSHAQAGADVVAPSDMMDGR
IGRIRQALEEAGYIHTQIMAYSAKYASNYYGPFRDAVGSSANLKGGNKKNYQMDPANSDE
ALHEVAMDINEGADMVMVKPGMPYLDVVRRVKTELQVPTFAYQVSGEYAMHKAAIMNGWL
KERETVFESLLCFKRAGADGILTYFAKEVAEWLAEDSAKAAQFLPKK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggtatccattcaaggtcaatttcctgggcgtcgtttacgccgcctgcgtaaacat
gatttcagccgtcgccttgtggccgaaaaccagttgtcggtgaacgatctgatctacccg
atgtttattttgatgggtaaagatcgccgtgaaaaagtcgattccatgccgggcgtagaa
cgtttatccatcgatttaatgctggaagaagcacagtatctcgctaacctcggtgtgcct
gcgattgctctgtttcctgtggtcaatcaggatgcaaaaagcctatgtgctgccgaagct
tacaaccctgaaggcttagttcaacgcgcagtgcgtgcgctgaaagagcatgtgccgcaa
atgggcgtgatcactgatgtggcattggatccattcacaactcatggacaagacggcatc
atcgatgagcaaggttatgtgttgaatgatgaaacaacggaagtgctagtgaagcaagca
ctgtcgcatgctcaagctggtgcggatgtggttgccccttccgatatgatggatggccgt
attgggcgcattcgtcaagcattggaagaggcggggtacattcatactcaaatcatggct
tattccgctaaatatgcctcgaattactatgggccattccgtgatgcggtcgggtcatct
gcgaatttaaaaggtggcaacaagaaaaactaccaaatggaccccgccaattccgatgaa
gctttgcatgaagtcgcgatggacatcaatgaaggtgcggacatggtgatggtgaagccc
ggcatgccctatctagatgtggtgcgccgtgtcaaaaccgagttgcaggtaccgaccttc
gcttaccaagtttccggtgagtatgcgatgcacaaagcggcaatcatgaatggttggttg
aaagagcgggaaacggtattcgaatctttactctgcttcaaacgtgcaggtgcagatggc
attttgacttactttgcgaaagaggtggctgagtggttggcggaagacagcgcaaaagcc
gcgcagttcttacctaaaaagtaa

DBGET integrated database retrieval system