KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC0119Help
Entry
VC0119            CDS       T00034                                 

Gene name
hemD
Definition
(RefSeq) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
vch00860  Porphyrin and chlorophyll metabolism
vch01100  Metabolic pathways
vch01110  Biosynthesis of secondary metabolites
vch01120  Microbial metabolism in diverse environments
Module
vch_M00121  Heme biosynthesis, glutamate => heme
vch_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VC0119 (hemD)
Enzymes [BR:vch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     VC0119 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 GATA-N
Motif
Other DBs
NCBI-GeneID: 2615139
NCBI-ProteinID: NP_229778
UniProt: Q9KVM2
Position
I:complement(113933..114715)
Genome map
AA seq 260 aa AA seqDB search
MIESVMTVLVTRPDEQGAELCQLLHQQGIPALHHPLLAISASPQLAALAEDLSSFDIIIA
VSQHAVIFSDQFLQHRRICWPNNAIYLAVGQKTAHVFSKACQQSVDYPEISDSEHLLALS
MLRDVAGKKVLILRGNGGRELIYSTLVERGATVRYQEAYCRHERPFAAAECVQKWQLAKV
DSLVITSSEQLAFFIRQFETSHLPWVQQLTLLVPSQRIATLAHQLGFHRIVVTLSAANRD
LVAALMPEKPTGTLSNDQQQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
ttgattgagagtgttatgacagtactggtcactcgtcctgatgaacaaggcgcagagctg
tgccagctgctgcaccagcagggcatccccgccctgcaccatccgctactcgccatctct
gccagccctcaacttgctgcgctggcagaagatttatcttcattcgatatcatcattgcc
gtcagtcaacatgccgtcatcttcagtgaccaatttctgcaacatcgccgaatttgttgg
ccaaataacgctatttaccttgccgttggtcaaaaaaccgcgcatgttttcagcaaagcc
tgccaacaatcagtagactatccagaaataagcgatagtgaacatctgctggcactcagt
atgctgcgtgatgtcgcaggtaagaaggtattgatcttacgtggtaatggtggtcgtgag
ctgatttattccaccttagtggaaagaggagcgactgtgcgctatcaagaagcgtattgt
cggcacgagcggccatttgccgccgccgagtgtgtccaaaaatggcagttggcgaaggtc
gactcactggtgatcaccagcagtgagcagttggctttttttatccgtcagttcgagaca
tcacacttgccatgggtgcagcagttaactttgctcgtacccagccaacggattgccact
ctcgcccaccaactaggatttcatcgcatcgtggtcacgctaagtgctgctaatcgcgat
ttagtcgcggcattgatgcccgaaaaaccaacaggaactctgagcaatgaccaacaacaa
taa

DBGET integrated database retrieval system