KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC0135Help
Entry
VC0135            CDS       T00034                                 

Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:vch00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
I:complement(129657..130673)
Genome map
AA seq 338 aa AA seqDB search
MNPEKNLYPYTQESSLEQALNFEIAQVWHTRSEGTYRSFDKTHIYWCSLKHPEHQKAVVI
VNGRIESAWKYQELCYDLFRQGFDVYTYDHRGQGRSERLTEDRQIGHVHEFQDYVTDLKA
LVEHFDLGHYQERFLLAHSMGGAIATRYIQTTPAHPFSALALSAPMFGVNMPWYLRPWAL
LITQIMAAVTLKPSYAPGYGPYHAKPFHLNLLTHSETRYQLFRELYEAHPELQIGGPSHR
WVWQSLMATKQCLQLTRQIKIPMLILQAGEEAIVCNRAQIRLFKKLSRTQKRAALCRIAG
ARHELLFEQDAYRNQTLDHILRFFADSTIDHKRQHHRP
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctgaaaaaaatctttatccttatacgcaagagtcgagtttggagcaagctctc
aactttgagatagctcaagtgtggcacactcgaagcgaaggaacctatcgcagttttgat
aaaacgcacatttattggtgtagtctcaagcatcctgagcatcaaaaagccgtagtgatt
gtgaatggcaggattgaatctgcgtggaaatatcaagagctgtgttatgacctattccgc
caaggttttgatgtttatacctatgatcaccgtggtcaaggacggtcagaacgtctgact
gaagatagacaaataggccatgtacatgagtttcaagattacgtgactgacttaaaagcc
ttagtcgagcatttcgatctcggtcactaccaagagcgctttttattagcccattctatg
ggtggcgcgattgctacgcgctatatccagaccactccagcgcacccctttagcgcactg
gccctgagtgctccgatgtttggcgtgaatatgccttggtatttaaggccatgggctttg
ctcatcactcaaattatggctgccgttaccctaaaacccagttacgctccgggttatggc
ccttatcacgctaaaccctttcatctcaacctgctcacccacagtgaaacccgctatcag
ttgtttcgtgaactgtatgaagcgcaccctgaactgcaaattggagggccgagtcaccgc
tgggtttggcagagcttaatggcgaccaaacagtgtttgcagttaacccgacaaatcaaa
atccccatgctgatcttacaagctggcgaagaagcgattgtgtgtaatcgggcgcaaatc
cggctcttcaaaaagctgtctcgcacccaaaaacgtgccgctttatgccgcatagcagga
gccagacatgaactgctttttgaacaagatgcctaccgaaatcagacgttagaccatatt
ttgcgttttttcgccgacagtactatcgaccataaaagacagcaccatcgaccatag

DBGET integrated database retrieval system