KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC0395Help
Entry
VC0395            CDS       T00034                                 

Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
vch00040  Pentose and glucuronate interconversions
vch00052  Galactose metabolism
vch00500  Starch and sucrose metabolism
vch00520  Amino sugar and nucleotide sugar metabolism
vch01100  Metabolic pathways
vch01130  Biosynthesis of antibiotics
Module
vch_M00362  Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    VC0395
   00052 Galactose metabolism
    VC0395
   00500 Starch and sucrose metabolism
    VC0395
   00520 Amino sugar and nucleotide sugar metabolism
    VC0395
Enzymes [BR:vch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     VC0395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 Smr
Motif
Other DBs
NCBI-GeneID: 2614992
NCBI-ProteinID: NP_230049
UniProt: Q9KUW4
Position
I:complement(420633..421508)
Genome map
AA seq 291 aa AA seqDB search
MMIKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVDEAIQAGITGMCIVTGRGK
HSIMDHFDMNYELEHQIRGTNKEELLGDIRKIIESANFTFIRQREMKGLGHAILTGKELV
GDEPFAVVLADDLCVNEEQGVLAQMVALYKQFRCSIVAVQEVPENETHKYGVIAGEMIKD
DLFRVDNMVEKPEPGTAPSNLAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALLKQAKA
GCVLAYKFKGKRFDCGSVEGYIEATNFCYENMYKKNDQKVELAKKSTHKGQ
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgatgattaagaagtgtctatttccggcagctggctacggtacccgattcctaccagcg
actaagtcgatgcccaaagagatgatgcctgttgttaacaaaccgctgattgagtacggt
gttgatgaagcgattcaagcgggtatcacaggcatgtgtattgtgacaggtcgtggtaag
cattcgatcatggatcactttgacatgaactacgagttagagcaccaaatccgcggtacg
aataaagaagagctattgggtgatatccgtaaaatcatcgaaagcgctaactttactttt
attcgccaacgcgaaatgaaaggcttgggtcacgctatcttaacgggcaaagagctggtc
ggtgatgagccgtttgccgttgtgctagcggacgacctgtgtgtgaacgaagagcaaggc
gtactggcacagatggttgcactgtacaaacagttccgctgctctatcgtcgctgtgcaa
gaggttccagaaaacgaaactcacaaatacggcgtgatcgcaggtgagatgatcaaagac
gatctgttccgcgtcgataacatggtcgaaaaaccagagccgggcacagcgccaagcaac
ctcgccatcattggccgttatatcctcacgccagatatttttgatctgattgagcagacc
gagccgggcaaaggcggtgaaattcaaatcactgacgcgctgctcaaacaagccaaagcg
ggttgtgtactggcttataaattcaaaggtaagcgcttcgactgtggtagcgttgaaggc
tatatcgaagccaccaacttctgctacgaaaacatgtacaagaaaaacgaccaaaaagtg
gagttggctaaaaagtcgacgcacaaaggtcagtaa

DBGET integrated database retrieval system