KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC0454Help
Entry
VC0454            CDS       T00034                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VC0454
   00330 Arginine and proline metabolism
    VC0454
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    VC0454
Enzymes [BR:vch01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     VC0454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
I:485299..486249
Genome map
AA seq 316 aa AA seqDB search
MRQTNNKESTMKPTADILASIIEEVRPLTSKGIVADYIPALAKVPSDKLGIAVFTNQGEV
ITAGDAQEGFSIQSISKVLSLTLAMGLYQPDELWSRVGKEPSGQAFNSLIQLEMEQGIPR
NPFINAGAIVVCDMLQSRLSAPRQRLLEFVRQLSGEPQIAYDKVVAASEMMHSDRNAAIA
YLMRSFGNFHNEVIPVLHNYFHACALKMSCVELAKTFSYLANKGVSVVTGETVITPTQSK
QTNALLATCGLYDGAGEFAYRVGMPGKSGVGGGIIAVVPGEMTIAVWSPALDQSGNSLAG
TRALELLAQRIGRSIF
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
ttgagacaaactaataataaagagtcaaccatgaagccaacagcagacattttagccagc
attattgaagaagttcgcccgctcaccagtaaaggcatcgtcgccgattacatccccgca
ctagcgaaagtaccgagtgataaattgggtattgctgtgtttaccaaccaaggggaagtc
atcacggcaggcgatgcacaggaagggttttcgattcagtcgatatccaaagtgctgagc
ttgacgctcgcgatgggcttgtatcagccagatgaactgtggagccgcgtgggtaaagag
ccttcaggacaagcatttaactcattgattcagcttgaaatggagcagggaatcccacgt
aatccatttatcaatgccggcgcgattgtggtgtgcgacatgctgcaaagtcgcctctct
gcacctcgtcagcgtctgttggagtttgtacgccagctcagcggcgagccgcaaattgct
tatgacaaagtcgtggctgcttcggagatgatgcacagtgatcgcaacgcggcgattgcg
tatttgatgcgttcatttggcaatttccacaatgaggttattccggtactgcacaactat
tttcacgcctgcgcattgaaaatgagctgtgttgagctggcgaaaaccttcagctatctg
gccaacaaaggtgtttctgtggtgacgggcgaaacggtgatcacgccaacccaaagcaaa
caaaccaatgccttactcgccacgtgcggcttgtatgatggggcaggagagtttgcctat
cgagttggtatgcccggaaaatcaggtgttggcggtgggattattgctgtggtgccggga
gaaatgacgattgcagtgtggtcccccgcgctggatcaatcgggtaactcgctcgcgggg
actcgcgcgttagagttactcgcgcagcggattggtcgctcaattttctaa

DBGET integrated database retrieval system