KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC0656Help
Entry
VC0656            CDS       T00034                                 

Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    VC0656
   00240 Pyrimidine metabolism
    VC0656
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    VC0656
   03430 Mismatch repair
    VC0656
   03440 Homologous recombination
    VC0656
Enzymes [BR:vch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     VC0656
DNA replication proteins [BR:vch03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     VC0656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
I:700767..701174
Genome map
AA seq 135 aa AA seqDB search
MLSSSHYLSAMDIQQWELIHPERLAGFQPRTQTLDHDCRLLLVANQPPQGAEILLLERIL
KSFQLELSMVRYIAPIQLSQLAYTGLEWIWFAGCDPLSHQAQKQLHSPRLSDIDGNTQYR
RALWQQICAHQGIAS
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgctttcttcttcacactatttgtccgcgatggacattcaacaatgggaattgatccat
ccagagcgtttggccggatttcagccgcgcacacaaacgctggatcacgattgccgactc
ttgttggtggccaatcaaccgccacaaggcgcggaaattctgttgctggagagaattctc
aaaagctttcagcttgagctgtcgatggttcgctacatcgcaccgattcagctcagtcaa
cttgcctatactggactcgagtggatctggtttgcgggctgcgatcccttatctcatcag
gctcaaaaacagctgcattcaccgcggttgagtgacattgatggcaatactcaataccgc
cgcgcgttgtggcagcaaatttgcgctcatcaaggaatcgcatcatga

DBGET integrated database retrieval system