KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC0734Help
Entry
VC0734            CDS       T00034                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VC0734
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VC0734
   00630 Glyoxylate and dicarboxylate metabolism
    VC0734
Enzymes [BR:vch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VC0734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
I:788949..790619
Genome map
AA seq 556 aa AA seqDB search
MFLVSVSRKEFMSINTAELTQHTTETKITQGKLAVVGTLSPEHQAIFPVEAQTFLQQLCE
RFAPRVDELLTLREQKQTLIDQGQLPDFLPETKDIREGSWKILGIPDDLQDRRVEITGPT
DRKMVINALNANVKVFMADFEDSMSPAWDKVLDGQINLRDAILGSISYTNPDNGKRYELN
ANPAVLICRVRGLHLKEKHVTYNGLAIPGSLFDFALYFYNNHRALLKKGSGPYFYLPKLQ
AYQEAQWWSDVFHFTEDYFGLDTGTIKATVLIETLPAVFQMDEILFSLKEHIVGLNCGRW
DYIFSYIKTLKKHPDRVLPDRQVVTMDKPFLNAYSRLLIYTCHKRGAFAMGGMAAFIPAK
DPALNEQVLQKIRGDKMLEATNGHDGTWVAHPGLADTAMAVFNEVLGERKNQLNVSRMAD
APITAAELLAPCDGSRSEHGMRHNIRVALQYIEAWISGNGCVPIYGLMEDAATAEISRAS
IWQWIQHGKTLDNGQVVTNELFRDYLKQEIEVVKSEVGESRFAQGRFTEAAELMERLTTS
QELPNFLTIPGYDYLP
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgttcttggtgagtgtttcaaggaaggaatttatgtcaatcaatactgctgaattaacc
caacacaccacggaaaccaaaatcacccaaggcaagcttgctgttgtgggtaccctttca
cccgaacatcaagcgattttccctgtcgaagcccaaacttttttacagcaactctgtgag
cgctttgcgccgcgagtggatgaattactgaccttgcgtgaacaaaaacaaacgcttatc
gaccaaggccagctacctgattttcttcctgaaaccaaagatatccgtgaaggaagctgg
aagattctcggcattccagacgatctgcaagatcgtcgcgtagagatcacggggccaacc
gatcgcaaaatggtgattaatgcactgaacgcgaatgtgaaagtctttatggctgacttt
gaagattcgatgtcgcccgcgtgggataaggtgttggatgggcagatcaacctgcgtgat
gcgattctgggcagcataagctataccaacccagacaatggcaagcgttatgagctcaat
gccaacccagcggtgctcatctgccgcgtgcgcggtctgcatctcaaagaaaaacatgtc
acctacaacggcttggcgattcccggttcactgttcgattttgcgctctatttttacaac
aaccatcgcgcactattgaaaaaaggcagtggcccttatttctacctacctaagctgcaa
gcttatcaagaggcgcagtggtggagtgacgtgttccatttcacggaagattattttggc
ttagacacaggcaccatcaaagcaacggtgttgattgaaactctgcctgcggtatttcag
atggatgagatcctcttctcactcaaagagcacattgtcggtctgaactgtggacgctgg
gattatattttcagctacatcaaaaccttgaaaaagcatcccgaccgcgtattgccggat
cgccaagtggtgaccatggataagcctttcctcaatgcgtattcccgtttgttgatttac
acctgtcataaacgcggcgcgtttgcgatgggcgggatggcggcgtttattccagccaaa
gatcctgcgctcaatgaacaagtgctacaaaaaattcgcggcgacaaaatgcttgaagcg
accaatggccacgatggcacttgggttgctcaccccggtttagcggataccgcgatggcg
gtgtttaacgaagtgcttggtgagcgcaaaaaccaactcaatgtgagccggatggccgat
gctccgataaccgcggccgagctattggcaccttgcgatggatcacgctctgagcatggc
atgcgccacaacattcgcgttgcgttgcaatacatcgaagcatggatttctggtaacggt
tgtgtgccgatctacggcttgatggaagatgcggcgacagcggagatttcacgcgcttcg
atttggcaatggatccaacacggcaaaacgttagataacgggcaagtggtcactaacgaa
ctgtttcgcgactacctcaaacaagagattgaggtggtgaaaagcgaagtgggtgagtcc
cgttttgcacaagggcgttttactgaagcggccgaattgatggagcgcttaacgaccagc
caagagctaccgaatttcttaaccatacctggctacgactacttgccgtag

DBGET integrated database retrieval system