KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC0736Help
Entry
VC0736            CDS       T00034                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
vch00630  Glyoxylate and dicarboxylate metabolism
vch01100  Metabolic pathways
vch01110  Biosynthesis of secondary metabolites
vch01120  Microbial metabolism in diverse environments
vch01200  Carbon metabolism
Module
vch_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    VC0736
Enzymes [BR:vch01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     VC0736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase TPR_14 ETC_C1_NDUFA4
Motif
Other DBs
NCBI-GeneID: 2615745
NCBI-ProteinID: NP_230385
UniProt: Q9KTZ4
Position
I:790749..792062
Genome map
AA seq 437 aa AA seqDB search
MTLTRRQQIEALEKDWATNPRWKNVKRTYTAEEVVSLRGSVVPANTIAQRGADKLWELVN
GSAKKGYVNCLGALTGGQAVQQAKAGIEAIYLSGWQVAADNNTAGTMYPDQSLYPVDSVP
SVVRRINNAFRRADQIQWSNGKSPQDEGGIDYFLPIVADAEAGFGGVLNAYELMKSMIEA
GAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLIAARLAADVAGTTTLVIARTDANAA
DLLTSDSDPYDADFVTGERTSEGFYRVRAGIDQAISRGLAYAPYADLVWCETAKPDLEEA
RKFAEAIHAQYPDQLLAYNCSPSFNWEKNLDAKTIAHFQQALSDMGYKYQFITLAGIHNM
WFNMFELAHAYAQGEGMRHYVEMVQRREFEAASKGYTFVAHQQEVGTGYFDKMTNTIQGG
NSSVTALTGSTEEDQFH
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgacactgactcgtcgccaacaaattgaagcactagaaaaagattgggcaaccaaccca
cgctggaaaaatgtgaaacgcacttacaccgctgaagaagtggtgagtttgcgcggctcg
gttgtaccagccaataccatcgcccaacgtggtgcagacaaactgtgggaactggtgaat
ggttcagcgaaaaaagggtatgtgaactgtttgggcgcactcactggcggccaagcggtg
caacaagccaaggcgggcattgaagcgatttatctctctggctggcaagtggcggcggat
aacaacaccgcaggcaccatgtacccagaccaatctctctatccagtggattctgtaccg
tcagtcgtacgccgcatcaataatgcgtttcgtcgcgctgaccagattcagtggtcaaac
ggcaaatcaccacaagatgaaggcggtattgattacttcctgccgattgtggcggatgcg
gaagccggttttggcggcgtactcaacgcttatgagttgatgaaatccatgattgaagcg
ggcgctgctggcgttcactttgaagaccaattggcttcggtgaaaaaatgtggccacatg
ggcggcaaagtattggtaccgactcaagaggcggtgcaaaaactgattgcagcacgcttg
gctgccgatgtcgcaggcacgactacgttagtgattgctcgcaccgatgctaacgccgcc
gatttgctcacttcagacagcgatccgtacgatgccgatttcgtgaccggtgagcgtact
tccgaaggtttctaccgtgtacgcgcgggcattgaccaagcgatttctcgcggcttggct
tacgcaccttacgcagatttggtgtggtgtgaaaccgcgaagccagatctggaagaagcg
cgtaaatttgctgaagcaattcatgcacaatacccagatcaactgttggcttataactgc
tcaccttcgttcaactgggaaaagaatctcgatgcgaaaaccatcgcccatttccagcaa
gcgctgtcggacatgggttacaagtaccagttcatcacattagcgggtattcacaacatg
tggttcaacatgtttgagttagcgcacgcttacgcgcaaggcgaaggtatgcgtcactat
gtcgaaatggtacagcgtcgcgaatttgaagcagcatccaaaggttacaccttcgtggcg
caccaacaagaagtggggacgggttacttcgataagatgaccaacaccattcaaggcggc
aacagttcggtgacggcactgaccggttcaaccgaagaagatcaatttcactaa

DBGET integrated database retrieval system