KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC0736Help
Entry
VC0736            CDS       T00034                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:vch01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:vch00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
I:790749..792062
Genome map
AA seq 437 aa AA seqDB search
MTLTRRQQIEALEKDWATNPRWKNVKRTYTAEEVVSLRGSVVPANTIAQRGADKLWELVN
GSAKKGYVNCLGALTGGQAVQQAKAGIEAIYLSGWQVAADNNTAGTMYPDQSLYPVDSVP
SVVRRINNAFRRADQIQWSNGKSPQDEGGIDYFLPIVADAEAGFGGVLNAYELMKSMIEA
GAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLIAARLAADVAGTTTLVIARTDANAA
DLLTSDSDPYDADFVTGERTSEGFYRVRAGIDQAISRGLAYAPYADLVWCETAKPDLEEA
RKFAEAIHAQYPDQLLAYNCSPSFNWEKNLDAKTIAHFQQALSDMGYKYQFITLAGIHNM
WFNMFELAHAYAQGEGMRHYVEMVQRREFEAASKGYTFVAHQQEVGTGYFDKMTNTIQGG
NSSVTALTGSTEEDQFH
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgacactgactcgtcgccaacaaattgaagcactagaaaaagattgggcaaccaaccca
cgctggaaaaatgtgaaacgcacttacaccgctgaagaagtggtgagtttgcgcggctcg
gttgtaccagccaataccatcgcccaacgtggtgcagacaaactgtgggaactggtgaat
ggttcagcgaaaaaagggtatgtgaactgtttgggcgcactcactggcggccaagcggtg
caacaagccaaggcgggcattgaagcgatttatctctctggctggcaagtggcggcggat
aacaacaccgcaggcaccatgtacccagaccaatctctctatccagtggattctgtaccg
tcagtcgtacgccgcatcaataatgcgtttcgtcgcgctgaccagattcagtggtcaaac
ggcaaatcaccacaagatgaaggcggtattgattacttcctgccgattgtggcggatgcg
gaagccggttttggcggcgtactcaacgcttatgagttgatgaaatccatgattgaagcg
ggcgctgctggcgttcactttgaagaccaattggcttcggtgaaaaaatgtggccacatg
ggcggcaaagtattggtaccgactcaagaggcggtgcaaaaactgattgcagcacgcttg
gctgccgatgtcgcaggcacgactacgttagtgattgctcgcaccgatgctaacgccgcc
gatttgctcacttcagacagcgatccgtacgatgccgatttcgtgaccggtgagcgtact
tccgaaggtttctaccgtgtacgcgcgggcattgaccaagcgatttctcgcggcttggct
tacgcaccttacgcagatttggtgtggtgtgaaaccgcgaagccagatctggaagaagcg
cgtaaatttgctgaagcaattcatgcacaatacccagatcaactgttggcttataactgc
tcaccttcgttcaactgggaaaagaatctcgatgcgaaaaccatcgcccatttccagcaa
gcgctgtcggacatgggttacaagtaccagttcatcacattagcgggtattcacaacatg
tggttcaacatgtttgagttagcgcacgcttacgcgcaaggcgaaggtatgcgtcactat
gtcgaaatggtacagcgtcgcgaatttgaagcagcatccaaaggttacaccttcgtggcg
caccaacaagaagtggggacgggttacttcgataagatgaccaacaccattcaaggcggc
aacagttcggtgacggcactgaccggttcaaccgaagaagatcaatttcactaa

DBGET integrated database retrieval system