KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC1047Help
Entry
VC1047            CDS       T00034                                 

Gene name
fadJ
Definition
multifunctional fatty acid oxidation complex subunit alpha (EC:1.1.1.35 4.2.1.17 5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VC1047 (fadJ)
   01212 Fatty acid metabolism
    VC1047 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    VC1047 (fadJ)
   00650 Butanoate metabolism
    VC1047 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    VC1047 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    VC1047 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VC1047 (fadJ)
   00310 Lysine degradation
    VC1047 (fadJ)
   00380 Tryptophan metabolism
    VC1047 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VC1047 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VC1047 (fadJ)
   00281 Geraniol degradation
    VC1047 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    VC1047 (fadJ)
Enzymes [BR:vch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     VC1047 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     VC1047 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     VC1047 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1116202..1118328
Genome map
AA seq 708 aa AA seqDB search
MDNNNAFQLSFDEQHYAWLAIDVPGEKMNTLQAAFAEEMQAVFATLNEKRGQIKGLIIHS
LKPDNFIAGADVRMLEACQSVHEAQALASQGQQMFQQLADLPFPVVAAIHGPCLGGGLEL
ALACDYRVCTEDEVTRLGLPEVMLGLLPGSGGTQRLPRLIGLLPALDLILTGKQLRAKKA
KKLGVVDACVPHSVLLDVAKRLLEEKGHKKRAQVTLPIKEKLLANTDLGRKLIFDQAAKK
TQQKTRGNYPAAQAILEVIQYGLEKGMHAGLEYEAKRFAELVMTRESKALRSIFFATTEM
KKDLGADAKPAPVAAVGVLGGGLMGAGISHVTVAKAKTSVRIKDVANDGVLNALNYNYKL
FDKQRQRKILTKAQLQAQMSQLSGGTGFVGFDRCDVVIEAVFEDLKLKQQMVADIEANAK
PTTIFATNTSSLPIHQIASQAQRPQNIVGLHYFSPVEKMPLVEVIPHATTSDETIATVVT
LARKQGKTPIVVKDCAGFYVNRILAPYMNEAAQVLMAGEPIEKLDAALLDFGFPVGPITL
LDEVGVDIGAKIMPILVKELGPRFQGPDVFDVLLKDNRKGRKSGKGFYTYKGSKKKEVDK
SVYKLLKLTPESKLNDKEIAMRCLLPMLNEAVRCLDEGIIRSARDGDMGAIFGIGFPPFL
GGPFRYMDTLGLTKVVEMMNQHTEKYGERFAPCDGLLTRAGLGEKFYP
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggataacaacaatgcatttcagctctcgtttgatgagcagcattacgcttggctggcg
attgatgtcccgggcgaaaaaatgaataccctgcaagcggcatttgcagaagagatgcaa
gccgtttttgcaacgctcaatgaaaagcgaggacagatcaaagggctgattatccactct
cttaagccggataactttattgcgggcgcggatgtccgcatgctggaagcttgccaatcg
gtacatgaagcacaagcgttagcctcgcaggggcaacagatgttccagcagcttgccgat
ttgcctttccctgtggtcgcggcgattcacggcccttgcttaggcggtggtttagaattg
gctctggcgtgtgattatcgtgtctgtactgaagatgaggtaacacgtctaggcttacca
gaagtgatgttaggtttgcttccgggctctggtggtacgcagcgtttaccacgtttgatt
ggtttactgcctgcgctggacctcatcttaacgggcaaacaattgcgtgccaaaaaggcc
aaaaaattgggtgtggttgatgcatgtgttccgcactcagtactgttggatgtggccaaa
cgtcttctagaagaaaaagggcacaaaaagcgcgctcaagttacgctaccgatcaaagaa
aaactgctcgccaataccgacttggggcgtaagttgatttttgaccaagcggccaagaaa
acgcagcagaaaacccgtggcaactaccccgcagcgcaagccattttagaggtcattcaa
tatggcctagaaaaagggatgcatgccggcttggaatatgaagccaagcgtttcgctgaa
ctggtgatgacccgagaatcgaaagcactgcgctccattttctttgcgaccacagagatg
aaaaaagatctcggtgcggatgccaaacccgcacctgtggcggctgtgggcgtgctcggt
ggtggtttgatgggggctggcatcagtcacgttactgtggcgaaagccaaaacatcggtg
cgcatcaaagatgtggcgaatgatggtgtgctcaatgccctcaattacaactacaagctg
tttgataagcagagacagcgcaagattttgactaaagcacagttgcaagcgcagatgtcg
cagctctcgggtgggactggctttgtgggttttgatcgctgtgatgtagtgatagaggct
gtgtttgaagacctgaaacttaagcaacaaatggtggcggatattgaagcgaatgccaaa
ccgacaacgatttttgcgaccaacacatcctcgctgccgatccatcagatcgcgagccaa
gcgcagcgtccgcaaaatattgtgggtttacattatttcagcccagttgaaaaaatgccg
ttggtggaagtgattcctcacgcgaccacctcggatgaaaccattgcgaccgtggtgaca
ttggcacgtaagcagggcaaaacaccgattgttgttaaagactgtgccggtttttatgtc
aaccgcattttagcgccttatatgaatgaagccgcgcaagtgctgatggcgggtgaacct
atcgaaaaactcgatgctgcgttactggattttggtttcccagtggggcctatcaccttg
cttgatgaagtaggggtcgatatcggagccaagatcatgccgattttggttaaagagctt
gggccgcgtttccaaggaccggacgtgtttgatgtgctgttgaaagataaccgtaaaggc
cggaaaagcggtaaaggtttctacacctacaaaggcagcaagaagaaagaagtcgataaa
tccgtttataaactgctgaagttaaccccggaatctaagctaaacgacaaagaaatcgcg
atgcgttgcttgttgcctatgctcaatgaggcggttcgttgtctcgatgaaggcattatt
cgcagtgcacgtgatggcgatatgggcgcgatttttggcatcggtttcccgccgttctta
ggtgggcctttccgttacatggacacgcttggtttaaccaaagtggtggaaatgatgaac
caacacaccgagaaatatggagagcggtttgctccatgtgacggtttgttgacgagagcg
ggattgggcgagaagttctacccctag

DBGET integrated database retrieval system