KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC1056Help
Entry
VC1056            CDS       T00034                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:vch00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    VC1056 (recR)
DNA repair and recombination proteins [BR:vch03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      VC1056 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1125183..1125785
Genome map
AA seq 200 aa AA seqDB search
MRTSHMLEHLMEALRCLPGVGPKSAQRMAFHLLQRDRKGGLQLAEALSQAMVEIGHCQEC
RTFTEQDVCHICSNPKRKENGQLCVVESPADIAALEATGQFSGRYFVLMGHLSPLDGIGP
SDIGLDTLDYRLQRGDISEVILATNPTVEGEATAQYIAELCREHQVTASRIAHGVPVGGE
LELVDGTTLSHSLLGRHKLF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaccagtcacatgctggaacatttgatggaagcattacgctgcctgccgggcgtt
ggcccaaaatcagcgcagcgtatggcattccatctgttacagcgcgatcgtaaaggtggt
ttacaactggctgaggcactgagtcaggcgatggtcgaaatcggccattgccaggaatgc
cgaacttttactgagcaggatgtttgccacatctgtagcaacccaaaacgtaaagaaaat
ggtcagttgtgtgtggttgaaagcccagcagatattgcggcgctagaagctaccggtcaa
ttttctggtcgctattttgtgttgatggggcacttatcaccgctggatggtattggcccg
agcgatattggcctcgatacgctggattatcgcttgcaacgcggtgatatcagtgaggtg
atcctcgccactaacccgacggtggaaggtgaggcgaccgcgcaatacattgccgagttg
tgtcgtgagcatcaagtcaccgcaagccgcattgcacatggtgttcccgtgggcggcgaa
cttgagttggtggatggcacgaccttatcccattcgctgttgggccgtcacaaactgttt
taa

DBGET integrated database retrieval system