KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC1169Help
Entry
VC1169            CDS       T00034                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VC1169 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VC1169 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VC1169 (trpA)
Enzymes [BR:vch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VC1169 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Structure
PDB: 

Jmol
Position
I:complement(1242248..1243054)
Genome map
AA seq 268 aa AA seqDB search
MNRYQALFQRLSAAQQGAFVPFVTIGDPNPEQSLAIMQTLIDAGADALELGMPFSDPLAD
GPTIQGANLRALAAKTTPDICFELIAQIRARNPETPIGLLMYANLVYARGIDDFYQRCQK
AGVDSVLIADVPTNESQPFVAAAEKFGIQPIFIAPPTASDETLRAVAQLGKGYTYLLSRA
GVTGAETKANMPVHALLERLQQFDAPPALLGFGISEPAQVKQAIEAGAAGAISGSAVVKI
IETHLDNPAKQLTELANFTQAMKKATKI
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgttatcaagccctatttcaacgcctgagcgccgctcagcaaggcgctttcgtt
cctttcgtgaccattggtgacccaaaccccgagcagtcactcgccatcatgcaaaccctg
attgatgcaggagcggatgcgcttgagcttggcatgccgttttcagatcctctggccgat
ggtccgacgattcaaggcgcgaacttacgtgcattagcggcgaaaaccacgccagatatc
tgttttgagctgatcgcgcagatccgtgcgcgtaaccctgagactccgattggcttactg
atgtatgccaacttggtttacgcacgcggcatcgacgatttttatcaacgctgccaaaaa
gctggcgtggattcggtactgattgccgatgtacccaccaacgaaagccagccttttgtg
gcggccgcagagaaatttggcattcaaccaatctttattgcgccaccaacggccagtgat
gaaaccttacgagcagttgctcaactcggtaaaggctacacttatttgctttcgcgcgct
ggggtgactggggctgaaaccaaagccaacatgcctgtgcatgccctgcttgaacgtctg
caacaatttgatgcgccaccagcactgctaggttttggtatttcagagcccgctcaagtt
aaacaagcgattgaagctggcgcagcgggagccatttccggatcggcggtggtaaaaatc
atcgaaacgcatttggataatccagctaagcagctgactgagctggcaaacttcactcaa
gccatgaaaaaagcaacaaaaatttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system