KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC1170Help
Entry
VC1170            CDS       T00034                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VC1170
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VC1170
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VC1170
Enzymes [BR:vch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VC1170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1243054..1244244)
Genome map
AA seq 396 aa AA seqDB search
MAKLNAYFGEFGGQFVPQILVPALDQLEQAFIDAQQDDAFRAEFMSLLQEYAGRPTALTL
TQNITKGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKHEIIAETGAGQHGVATAL
ACALLGLKCRVYMGAKDVERQSPNVFRMRLMGATVIPVHSGSATLKDACNEALRDWSASY
ETAHYLLGTAAGPHPFPTIVREFQRIIGEETKNQILAREGRLPDAVIACVGGGSNAIGMF
ADFIEEESVRLIGIEPAGKGIHTHQHGAPLKHGKTGIFFGMKAPLMQDEHGQVEESYSVS
AGLDFPSVGPQHAYLNAIGRAEYESITDDEALDAFQALARNEGIIPALESSHALAHAIKM
AYAEPDKEQLLVVNLSGRGDKDIFTVHKLLEDKGAL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattaaacgcctattttggcgaattcggtgggcagtttgtgccacaaattttg
gttccggcactcgatcaactggaacaagcttttattgatgcccagcaggatgatgctttt
cgcgctgaatttatgagcctactgcaagagtacgcgggtcgccccactgcgctgacactc
acgcaaaacatcaccaaaggcaccaaaaccaaactctatttgaagcgtgaagatctactg
cacggcggcgcgcacaaaaccaaccaagttttgggccaagccctgctcgccaaacgtatg
ggcaaacatgaaattatcgccgagacaggcgcaggtcaacacggtgtcgcaaccgcatta
gcctgtgcactgcttggcctaaaatgccgcgtgtacatgggtgcaaaagacgttgagcgc
caaagcccaaacgtgttccgtatgcgcttaatgggtgccaccgtgatccctgttcattca
ggttcagcaacgctaaaagatgcctgtaacgaagcgctgcgtgactggtcagccagctat
gaaactgcgcattatctgctcggtactgcggcaggccctcacccattcccaaccatagtg
cgtgaattccaacgcattattggtgaagaaaccaaaaaccaaatccttgctcgtgaaggt
cgtttgcccgatgcggtgatcgcttgtgtcggtggcggctcaaacgcgattggtatgttt
gccgatttcatcgaagaagaatccgtacgtttgatcggtattgagccagcaggtaaaggc
attcatacccatcaacatggtgcaccactcaaacacggtaaaactggtatcttcttcggc
atgaaagcaccgttgatgcaagatgaacatggtcaagtggaagagtcttactctgtctct
gcggggctggatttcccatcggtgggtccacaacatgcttacctcaacgccattggtcgt
gcggaatatgaaagcattaccgatgatgaagcactcgatgcgttccaagcgttggcacgt
aacgaaggcatcattccagcgctggagtcttcacacgctctcgcgcatgcaatcaaaatg
gcgtatgccgaaccagacaaagagcagttgctcgtggttaacctttcgggccgaggtgat
aaggatattttcaccgtacacaaattacttgaagacaaaggagcgttgtaa

DBGET integrated database retrieval system