KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC1171Help
Entry
VC1171            CDS       T00034                                 

Gene name
trpC, trpF
Definition
bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase (EC:4.1.1.48 5.3.1.24)
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VC1171 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VC1171 (trpC)
Enzymes [BR:vch01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     VC1171 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     VC1171 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1244285..1245694)
Genome map
AA seq 469 aa AA seqDB search
MSEQLSEHISVQTAQMAQVLVKIVNDKYQWIEERKAKQPLASFHPLLTRSERDFYQALSG
DNTVFILECKKASPSKGLIREEFDLDYIASVYGEYASAISVLTDEKYFQGRFEFLPQVRA
QVAQPVLCKDFMVDPYQVYLARHYQADAILLMLSVLNDDQYRELAAVAHDLGMGVLTEVS
NEQELKRAVDLQAKVIGINNRNLRDLTTDLNRTKQLAPLIPQGTIIISESGIYTHQQVRD
LAEFANGFLIGSSLMAQSNLELAVRKIVLGEHKVCGLTHPDDAVKAYQAGSVFGGLIFVE
KSKRFVDVEQARLTMSGAPLQYVGVFQNHPAAQVADIATKLGLFAVQLHGEEDSAYVSEL
RASLPESIEIWKAYGVSDALPELLPEHIDRHLLDAKVGEQSGGTGRSFDWRLLPKHSDLM
LAGGLSAENVAQAAQLGCRGLDFNSGVESAPGKKDANQLQQVFQQLRNY
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagcagttgtctgagcatatttccgtacaaaccgcgcaaatggcgcaagtgctg
gtcaaaatcgtcaacgataaataccaatggattgaagagcgcaaagccaagcaacctctt
gctagctttcatccattactgactcgctcagagcgcgatttctatcaagccttgagcggc
gataacaccgtattcattctcgaatgcaaaaaagcctcaccttcaaaaggattgatccgc
gaagagtttgatctcgattacatcgcctctgtgtatggcgagtacgccagtgccatttcg
gtactgactgacgagaaatatttccaaggtcgttttgagtttttgccgcaagtgcgcgct
caagtggctcagcctgtcttgtgcaaagattttatggtcgacccgtatcaggtttatctg
gcgcgtcattatcaagcggatgcgattttgctgatgctgtctgtgctcaatgatgatcaa
tatcgtgaactggctgctgtggcgcacgaccttggtatgggcgtactcaccgaagtcagc
aacgaacaagaattgaaacgtgcagttgatctgcaagcgaaagtcatcggcatcaataac
cgcaatctgcgtgatttgaccaccgacctaaatcgcaccaagcagttggcgccgctcatt
ccacaaggcaccatcattatttccgaatccggtatttatacccatcagcaggtgcgtgat
ttggctgaatttgccaatggtttcttgattggtagctcgctgatggcgcaaagcaatctt
gaactggcggtgcgaaaaattgtgctaggtgaacataaggtgtgcggtttgactcatcct
gatgatgcggtgaaagcctaccaagccggttccgtttttggtggattgatttttgttgag
aagtccaaacgctttgtcgatgtagaacaagctcgcctgaccatgagcggcgcgccgcta
cagtatgtcggcgtgtttcaaaatcacccagcagcacaagtcgccgatattgcaaccaaa
cttggcttatttgcggtgcaactgcacggtgaggaagactctgcgtatgtaagcgaactg
cgcgcttcccttccagaatccattgaaatttggaaagcgtatggcgtgagtgatgcttta
cctgagctactaccagagcacatcgataggcatctgctcgatgccaaagtcggcgaacag
agtggcggcacaggacgcagttttgattggcgcttgctgccaaaacatagcgacctgatg
ctcgccggcggcttgagcgccgagaatgtcgcccaagcggcgcaacttggctgccgcgga
ctcgatttcaactctggcgtggaaagcgctccgggtaaaaaagacgccaaccagttacaa
caggttttccaacagttacggaattattag

DBGET integrated database retrieval system