KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC1303Help
Entry
VC1303            CDS       T00034                                 

Definition
para-aminobenzoate synthase component I
Orthology
K01665  
para-aminobenzoate synthetase component I [EC:2.6.1.85]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Folate biosynthesis
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vch00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
I:complement(1383845..1385221)
Genome map
AA seq 458 aa AA seqDB search
MNNNQTLSIEHKKLTYHPDIAKQFFTSIEQQPWAMLLRSASTTHMDSRFDILVANPFATL
VTFGDETEIHAQNGVTLSREDPFALLADIQEQYLPQVTDESELPFVGGALGYFSYDLGRR
VEVLPSLAEQDIAMPDMAVGIYSWALVVDHQQHTAQLVGQNVEDAWGWLNQQEAIKPSEV
TDFALTSPWRSNMSYTAYQDKFARVQDYLRSGDCYQINLAQRFQAHYTGSEWQAYLKLEK
GNQAPFSAFLRLPQGAILSVSPERFLQVCDRVIETKPIKGTRPRHADKQQDALLKQDLVS
AEKDQAENLMIVDLLRNDIGRVAKPGSVHVPKLFDVESFPAVHHLVSTIRATLDEQYQAA
DLLRACFPGGSITGAPKVRAMEIIEELEPHRRSAYCGSIGYLSRHGKMDTSITIRTLVAY
QQQLYAWAGGGLVADSEGAAEYQETLDKLSRILPTLES
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaataacaaccaaactttgtcaattgaacacaaaaaattaacttatcaccctgatatt
gctaaacaatttttcacatccattgagcagcaaccttgggcaatgctgctgcgctctgcg
tctaccacccatatggatagccgctttgatattctggtcgccaatcctttcgccacttta
gtgacttttggtgatgaaactgaaattcacgcccagaacggcgtgacattgtcacgagaa
gatccttttgcgcttcttgctgacatccaagagcagtatcttcctcaagtgactgatgag
tcggagttaccttttgttggcggtgctctggggtatttttcctatgatttaggacgccga
gtcgaagtcctccctagcttagcagaacaagatattgctatgcccgatatggccgtgggc
atctattcttgggcgctcgtggtcgatcaccaacagcacaccgcgcaattggtcggacaa
aatgttgaagacgcttggggttggttaaaccaacaagaggcgataaagccaagcgaagta
actgactttgctctcacatcgccttggcgatccaatatgagctataccgcctatcaagat
aaatttgctcgtgtacaggactatttacgctcgggagactgttaccagatcaacctcgcg
cagcgttttcaggctcactacactggtagtgaatggcaagcgtatttgaagctggaaaaa
ggtaatcaagcgcccttctccgcctttttgcgtttgccacaaggcgcaattttgagtgtt
tctccagaacgttttctgcaagtttgtgatcgagtgattgaaaccaaaccgatcaaaggc
acacgtccacgccatgccgacaagcaacaagatgccctactcaagcaagatttagtcagc
gcagaaaaagatcaggccgagaatttaatgattgtcgatctgctgcgtaatgatattggt
cgtgtggcaaagccgggtagcgtgcatgtacctaagttgtttgatgtcgaaagctttccc
gccgtgcaccatctggtgagcacgattcgcgcaacactggatgagcaataccaagccgcc
gatctgttacgcgcctgttttcccggcggttcgattacgggagcgcccaaagtgcgggca
atggaaatcattgaggagctcgagccgcatcgccgtagcgcttattgtggctcaattggc
tatctcagccgtcatggaaaaatggataccagcatcacgatccgcactttagtggcctat
cagcagcagctttacgcttgggcgggtggcggcttggtggctgacagcgaaggcgctgcg
gagtatcaagaaacgctagataagttaagccgaattcttccaaccctagaatcctaa

DBGET integrated database retrieval system