KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC1401Help
Entry
VC1401            CDS       T00034                                 

Definition
protein-glutamate methylesterase CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:vch00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    VC1401
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    VC1401
Enzymes [BR:vch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     VC1401
Two-component system [BR:vch02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   VC1401
Bacterial motility proteins [BR:vch02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    VC1401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
I:complement(1491209..1492285)
Genome map
AA seq 358 aa AA seqDB search
MKILVVDDSALMRTTISDILQNIPNAEIKTARDGMDAIDKVMKWQPDVMTLDINMPNMDG
LTCLTQIMVERPLPIVMLSSLTHEGAITTLEALYLGAVDFVAKPGGTICGRLQEVAPLIR
EKVRAAAKMRVKVHTQLSVSPAEVEHKHKSPVVENNEDHQLAIMGVSTGGPGTVETILRH
LPADFSLPIIVNQHMPESFTAAFAQRLNRHLQQPVKEINRALVLEAGTVYVCKGDRDCIV
TLRDGKLAAMPTPNDSHFSWHPSVSKLVASAIRTCGEDNLLCVMLTGMGDDGATEMAQVA
QGNGIVFAQEPTTCVVPSMPEALLKRVPHIPTGTPEHLAYLMTEVVRQSSRELHYGNH
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaagattttagttgtcgatgattctgcgttaatgcgcaccaccattagcgacatattg
caaaacattccgaatgccgagattaaaacagcacgtgatggtatggatgccatcgacaaa
gtgatgaaatggcaaccggatgtgatgacgttagacatcaatatgcccaacatggatggt
ctaacttgccttacgcaaatcatggttgaacgtcccttgccgattgtcatgctctcatcc
ctcacccatgaaggtgccattacaacgctcgaagcgctttatcttggtgcggtagacttt
gtcgccaaacccggaggcactatctgcggtcgattacaagaagtcgcaccactgatccgt
gaaaaagttcgcgcggcagcgaaaatgagagtcaaagttcacacgcagctttcggtatca
ccagcagaagtagagcacaaacataagtcacctgtggtggaaaataatgaagaccaccag
cttgcgatcatgggggtttcgacaggagggcccggcactgttgaaacgatactgcgccat
ctgcccgccgatttctcattacctattattgttaaccaacacatgccagagagcttcact
gccgcctttgcacaaaggcttaatcgccatctgcaacaacccgtgaaagagattaaccgt
gctttagtgcttgaggctggtaccgtttatgtttgcaagggtgaccgagactgcattgtc
acgctacgtgatggtaaattggctgccatgcccacgccaaatgatagccatttttcatgg
catcccagcgtctccaaactggttgccagcgccatacgcacttgtggagaagataactta
ttgtgcgtcatgctaacgggaatgggcgacgacggtgccactgaaatggctcaggttgct
caaggaaacggtattgtttttgcccaagaacccacaacctgcgtagtccccagtatgccg
gaagcattacttaaacgtgtaccccatattccaacaggaactccagagcacttagcttat
ctgatgaccgaagtggtgagacagtccagtagggagcttcactatggcaatcattaa

DBGET integrated database retrieval system