KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC1457Help
Entry
VC1457            CDS       T00034                                 

Definition
cholera enterotoxin subunit A
Orthology
K10928  
cholera enterotoxin subunit A [EC:2.4.2.36]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Vibrio cholerae infection
Vibrio cholerae pathogenic cycle
Class
Human Diseases; Infectious diseases; Vibrio cholerae infection [PATH:vch05110]
Human Diseases; Infectious diseases; Vibrio cholerae pathogenic cycle [PATH:vch05111]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Structure
PDB: 

Jmol
Position
I:complement(1567338..1568114)
Genome map
AA seq 258 aa AA seqDB search
MVKIIFVFFIFLSSFSYANDDKLYRADSRPPDEIKQSGGLMPRGQSEYFDRGTQMNINLY
DHARGTQTGFVRHDDGYVSTSISLRSAHLVGQTILSGHSTYYIYVIATAPNMFNVNDVLG
AYSPHPDEQEVSALGGIPYSQIYGWYRVHFGVLDEQLHRNRGYRDRYYSNLDIAPAADGY
GLAGFPPEHRAWREEPWIHHAPPGCGNAPRSSMSNTCDEKTQSLGVKFLDEYQSKVKRQI
FSGYQSDIDTHNRIKDEL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagataatatttgtgttttttattttcttatcatcattttcatatgcaaatgat
gataagttatatcgggcagattctagacctcctgatgaaataaagcagtcaggtggtctt
atgccaagaggacagagtgagtactttgaccgaggtactcaaatgaatatcaacctttat
gatcatgcaagaggaactcagacgggatttgttaggcacgatgatggatatgtttccacc
tcaattagtttgagaagtgcccacttagtgggtcaaactatattgtctggtcattctact
tattatatatatgttatagccactgcacccaacatgtttaacgttaatgatgtattaggg
gcatacagtcctcatccagatgaacaagaagtttctgctttaggtgggattccatactcc
caaatatatggatggtatcgagttcattttggggtgcttgatgaacaattacatcgtaat
aggggctacagagatagatattacagtaacttagatattgctccagcagcagatggttat
ggattggcaggtttccctccggagcatagagcttggagggaagagccgtggattcatcat
gcaccgccgggttgtgggaatgctccaagatcatcgatgagtaatacttgcgatgaaaaa
acccaaagtctaggtgtaaaattccttgacgaataccaatctaaagttaaaagacaaata
ttttcaggctatcaatctgatattgatacacataatagaattaaggatgaattatga

DBGET integrated database retrieval system