KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC1558Help
Entry
VC1558            CDS       T00034                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vch00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
I:complement(1669192..1670628)
Genome map
AA seq 478 aa AA seqDB search
MAKSIFPNDFLWGGAVAAHQVEGGWDQGGKGVSIVDVLTRGAHEVPRRITDGVMEDEFYP
NHQAVDFYHHYKEDIALFAEMGFKCFRTSIAWTRIFPNGDEAEPNEAGLQFYDDLFDELL
KHNIEPVITLSHFEMPLHLVKQYGSWLNRDLIDHFTKFAQVVMTRYQHKVKYWITFNEIN
NQCNWKLPIFGYCNSGMLYAEQDRPEQAMYQVLHHQFIASALVVKLGHEINPDFKIGSMI
HMMPLYPATSRPEDVLLAQELMREKYLFSDVQVRGYYPSYLRKEWQRKGIEIEMQAGDEQ
ILRQGCADYLAISYYMTNIVSAAPEQEGETTSLFETSRLNPYLPASDWGWQIDPQGLRYA
LSELYERYQKPIFVVENGLGALDTVEADGSINDDYRIRYLSEHIAAVKQAIDYDGVEVMG
YTPWGCIDCVSFTTGEYKKRYGFIYVDKHDDGSGTMARAKKKSFYWYQQVIASNGEKL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggctaagtctatttttcctaacgattttttgtggggtggtgcggtagcggcgcatcaa
gtggaaggcggttgggatcaaggtggtaaaggcgtgagcattgttgatgtgctgactcgt
ggtgcgcacgaagtgccacgccgtattaccgatggggttatggaagacgaattttaccca
aaccatcaagcggtcgatttttatcatcactataaagaagatatcgcgctgtttgctgag
atgggttttaaatgtttccgtacgtctattgcgtggacacggattttcccgaatggcgat
gaagccgagcccaatgaagcaggattacagttttatgatgatctgtttgatgagctgtta
aagcacaatattgaacctgtcattacgttgtcacattttgaaatgccactgcatctggta
aagcagtatggcagttggctcaaccgcgacttgattgatcacttcaccaaatttgcgcaa
gtcgtgatgacccgttaccagcataaggtgaaatactggatcacctttaatgaaatcaat
aaccaatgcaactggaagctgccgatctttggttattgcaactcaggtatgctttacgct
gagcaagaccgcccagaacaagccatgtaccaagtgctacatcaccaatttattgccagc
gcattagtggtgaaactggggcacgagatcaatccggattttaaaattggcagcatgatc
catatgatgccgctgtatcctgccacctcacgtccggaagatgtgttgttggcacaagag
ttgatgcgtgagaaatatctgttcagtgacgtacaggttcgtggctattaccccagttat
ctgcgcaaagaatggcaacgcaaaggcatcgaaattgagatgcaagctggtgatgagcag
atcctgcgccaaggctgcgccgattatctcgccatcagctactacatgaccaacattgtc
tctgcagcgccagaacaagagggcgaaaccacctctttgtttgaaaccagccgcttaaac
ccgtatcttcctgcgtccgattggggatggcagattgatccacaaggtttacgttatgcg
ctttctgagttgtatgagcgttaccaaaaaccgatttttgtggtagaaaatggcctcggc
gcgctagacaccgtcgaagcggatggttcaatcaacgatgattaccgaattcgctacctc
tctgagcatatcgcggcagtcaaacaagcgatcgactatgacggtgttgaagtgatgggt
tacaccccttggggctgtatcgactgtgtatcgttcaccactggcgagtacaaaaaacgc
tacggctttatctatgtggataaacacgatgatggcagtggcaccatggcgcgcgctaag
aaaaagagcttctactggtatcaacaagtgatcgccagtaacggtgaaaagctttaa

DBGET integrated database retrieval system