KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC1846Help
Entry
VC1846            CDS       T00034                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:vch03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
I:complement(1985956..1986570)
Genome map
AA seq 204 aa AA seqDB search
MIGRLRGTLIEKLPPQILIEVGGIGYEVQMPMSCIYELPNIGEEAIIYTHFVVREDAQLL
YGFNTVSERALFREVIKANGVGPKMGLAILSGMTANQFVTCVEKEDISTLIKLPGVGKKT
AERLVVEMKDRLKGWGAGDLFTPATDAAPVDSTPVIAQNAQEEAMSALLALGYKPPQASK
AVSQVAKAGMSSEELIREALKSMV
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgattggacgtcttcgcggtacgctgattgaaaagttacctcctcaaattttgattgag
gtcggtggtattggctatgaagtgcaaatgccgatgagctgtatttatgaactgccgaat
attggggaagaagccatcatttatacccactttgtagttcgagaagatgcacagctactt
tatggctttaataccgttagcgaacgcgctctgtttcgtgaagtaatcaaagccaatggc
gtagggccgaaaatggggcttgcgatcctctctggcatgacagccaatcagtttgtgact
tgtgtggaaaaagaagatatctctaccctcattaaattaccgggagtcgggaagaagacg
gctgagcgattggtggtggaaatgaaagatcgcctgaaaggatggggagcgggtgacctc
tttacacctgcaaccgatgcggcccctgtcgattctacgcccgtgattgctcaaaatgct
caggaagaagccatgagcgcgctattggcgctaggttacaagccccctcaagcttccaaa
gcggtatcgcaagtggctaaagcaggaatgagcagtgaagagttgattcgtgaagcgctc
aaatctatggtgtaa

DBGET integrated database retrieval system