KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC1846Help
Entry
VC1846            CDS       T00034                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:vch00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    VC1846 (ruvA)
Enzymes [BR:vch01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     VC1846 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
I:complement(1985956..1986570)
Genome map
AA seq 204 aa AA seqDB search
MIGRLRGTLIEKLPPQILIEVGGIGYEVQMPMSCIYELPNIGEEAIIYTHFVVREDAQLL
YGFNTVSERALFREVIKANGVGPKMGLAILSGMTANQFVTCVEKEDISTLIKLPGVGKKT
AERLVVEMKDRLKGWGAGDLFTPATDAAPVDSTPVIAQNAQEEAMSALLALGYKPPQASK
AVSQVAKAGMSSEELIREALKSMV
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgattggacgtcttcgcggtacgctgattgaaaagttacctcctcaaattttgattgag
gtcggtggtattggctatgaagtgcaaatgccgatgagctgtatttatgaactgccgaat
attggggaagaagccatcatttatacccactttgtagttcgagaagatgcacagctactt
tatggctttaataccgttagcgaacgcgctctgtttcgtgaagtaatcaaagccaatggc
gtagggccgaaaatggggcttgcgatcctctctggcatgacagccaatcagtttgtgact
tgtgtggaaaaagaagatatctctaccctcattaaattaccgggagtcgggaagaagacg
gctgagcgattggtggtggaaatgaaagatcgcctgaaaggatggggagcgggtgacctc
tttacacctgcaaccgatgcggcccctgtcgattctacgcccgtgattgctcaaaatgct
caggaagaagccatgagcgcgctattggcgctaggttacaagccccctcaagcttccaaa
gcggtatcgcaagtggctaaagcaggaatgagcagtgaagagttgattcgtgaagcgctc
aaatctatggtgtaa

DBGET integrated database retrieval system