KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC2085Help
Entry
VC2085            CDS       T00034                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
vch00020  Citrate cycle (TCA cycle)
vch00640  Propanoate metabolism
vch00660  C5-Branched dibasic acid metabolism
vch01100  Metabolic pathways
vch01110  Biosynthesis of secondary metabolites
vch01120  Microbial metabolism in diverse environments
vch01130  Biosynthesis of antibiotics
vch01200  Carbon metabolism
Module
vch_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vch_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VC2085 (sucC)
   00640 Propanoate metabolism
    VC2085 (sucC)
   00660 C5-Branched dibasic acid metabolism
    VC2085 (sucC)
Enzymes [BR:vch01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     VC2085 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-GeneID: 2613341
NCBI-ProteinID: NP_231717
UniProt: Q9KQB5
Position
I:complement(2244073..2245239)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFAEFGLPVPEGYACDTPQEAFEAAGRISTAKKVVKCQVHAGGRGKAGGV
ELHDTKEGVKAFAQKWLGKNLVTYQTDANGQPVSKILVEEASNIANELYLGAVVDRSTRR
IVFMASTEGGVEIEKVAEETPELIHKAAIDPLVGPQAYQGRELAFKLGLQGDQIKQFVKI
FMGLGEMFAQYDLALLEINPLVITAEGNLLCLDGKINIDSNAMYRQPKLRQMHDASQEDA
REAHAAKWELNYVALDGNVGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVAE
AFKIILSDTNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVSVPVVVRLEGTNAELGRKV
LAESGLDIIAAVSLTDAAQKVVAAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgaatatcaagctaaacagctgtttgcagaattcggtttgcctgtaccg
gaaggttatgcttgtgatacgccacaagaagcgtttgaagctgcaggacgcatcagcaca
gccaagaaagtcgtaaaatgccaagttcacgcaggtggacgtggtaaagcaggtggcgtt
gaactgcatgacactaaagaaggcgtaaaagcgtttgcacaaaaatggctaggtaagaac
ctagtaacttatcaaacggatgcaaatggccaaccggtttcaaaaattttggttgaagaa
gcatcaaatatcgctaatgagctttatcttggtgcggtagttgaccgttctacacgtcgt
atcgttttcatggcatcgactgaaggtggcgtggaaattgagaaagtggcagaagaaact
ccagaactgatccacaaagcggcgattgatccactggttggcccacaagcctaccaaggt
cgtgaattggcgttcaagctaggcctgcaaggtgatcaaatcaaacagttcgtgaaaatc
ttcatgggcttgggtgaaatgtttgctcaatatgatctcgcactgctggaaatcaacccg
ctggtgattactgcggaaggtaacttgctgtgccttgatggcaaaatcaacatcgactcc
aatgctatgtaccgtcaacccaaactgcgtcaaatgcacgatgcttctcaagaagatgcg
cgcgaagcacacgcagcgaaatgggagcttaactacgttgcgctggatggtaacgtaggc
tgtatggttaacggtgctggccttgcgatgggtacgatggacattgttaacttgcacggc
ggaaaacccgcaaacttccttgatgttggtggcggcgcgaccaaagagcgtgttgcagaa
gccttcaaaatcatcttgtctgataccaatgtaaaagccgtactggtgaacatctttggt
ggcattgtgcgctgcgacatgattgcagaaggcattatcggtgcagtgaaggaagttggt
gtaagcgttccagtggttgtgcgtcttgaaggtacaaacgcagaacttggacgtaaagta
ctggcagaatcaggtctagatattattgcagctgtatctttgacagacgcagcgcaaaaa
gtagttgccgcggcggagggcaaataa

DBGET integrated database retrieval system