KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC2152Help
Entry
VC2152            CDS       T00034                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VC2152
  Amino acid metabolism
   00300 Lysine biosynthesis
    VC2152
Enzymes [BR:vch01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     VC2152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Structure
PDB: 

Jmol
Position
I:2303265..2304398
Genome map
AA seq 377 aa AA seqDB search
MTDSPVLALAKELISRQSVTPADAGCQDLMIERLKALGFEIESMVFEDTTNFWARRGTQS
PLFVFAGHTDVVPAGPLSQWHTPPFEPTVIDGFLHGRGAADMKGSLACMIVAVERFIAEH
PDHQGSIGFLITSDEEGPFINGTVRVVETLMARNELIDMCIVGEPSSTLAVGDVVKNGRR
GSITGDLKVKGTQGHVAYPHLANNPVHKALPALAELAATQWDEGNAYFPPTSFQIPNLQA
GTGASNVIPGEFDVQFNFRFSTELTDEEIKRRVHSVLDAHGLDYDVKWTLSGQPFLTDTG
ELLAAVVAAVEEVNHQAPALLTTGGTSDGRFIAQMGAQVVELGPVNATIHKVNECVRIAD
LEKLTDMYQKTLNHLLG
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgacagatagccctgtactggctctggcaaaagagctgattagccgccaatccgttact
cctgccgacgcaggatgtcaggatctgatgattgagcgcttaaaagcgctgggtttcgaa
attgaaagcatggtgtttgaagacaccaccaacttctgggctcgccgcggcacgcaatct
cccctgtttgtttttgcaggtcataccgatgtggtgcctgccggccctttgtcgcagtgg
cacactcctccttttgagccgactgtgattgatggtttcctgcatgggcgtggcgcagca
gatatgaaaggctcgctggcttgtatgattgtggcggtagagcgttttattgccgaacat
cccgatcatcaaggctcaatcggttttttgatcacttctgatgaagaaggcccctttatc
aacggtaccgtccgtgtcgtagaaacgctaatggcacgtaacgaactgatcgatatgtgt
atcgtcggtgagccgtccagtaccctagccgtaggcgatgtggtgaaaaatggccgtcgt
ggctccatcacgggggatttgaaggtaaaaggcactcaaggccatgttgcttatccgcat
ctggctaataatcccgtgcataaagcgctccccgcattggccgaactcgccgccacccaa
tgggatgaaggtaacgcctatttcccccccaccagctttcaaattcctaacctgcaagcg
ggtactggcgcatcgaatgtcatccccggtgaatttgatgtgcagtttaacttccgcttt
agtacagagctcaccgatgaagagatcaaacgccgcgtacattcggtcttggatgctcac
gggctcgattacgatgtgaaatggactctcagcggccaacccttcctgaccgatacgggc
gaactactggccgcagtagtcgcggcagtagaggaagtaaaccatcaagctcctgcgtta
ttgacgacaggcggaacatctgatggtcgcttcattgcccaaatgggcgcacaagtggtt
gagctcggtcccgtcaatgccaccattcacaaggtaaacgagtgtgtacgtattgcggat
ttagagaaattgaccgatatgtatcaaaaaaccttaaatcatcttttaggctaa

DBGET integrated database retrieval system