KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC2418Help
Entry
VC2418            CDS       T00034                                 

Definition
(RefSeq) thiol:disulfide interchange protein DsbC
  KO
K03981  thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Brite
Enzymes [BR:vch01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     VC2418
Chaperones and folding catalysts [BR:vch03110]
 Protein folding catalysts
  Protein disulfide isomerase
   VC2418
Secretion system [BR:vch02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   VC2418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin_2 DsbC_N DSBA
Motif
Other DBs
NCBI-GeneID: 2613087
NCBI-ProteinID: NP_232048
UniProt: Q9KPF0
Position
I:complement(2592606..2593358)
Genome map
AA seq 250 aa AA seqDB search
MSVLRRLTWLAFPLLSMAFNVQANTAPAQLNKAELEQRFAKLGLQVEEIKTSDINGLLEV
QTSGGVLFSSPDGEHFIAGTLYALDGNGGYVDVLAKRQAPLNAKKIAALQDSMIEFKAPN
EKYAITVFTDITCGYCVRLHSQIKEYNDLGITVRYLAYPRQGPQGQVADQMAAIWCSNDP
KAAMHDAKVNRKTITADKDIAQCQKTIAQHYMLGHELGISGTPAIFLPNGEMVGGYLPAP
QLLQRLQATQ
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtactgcgccgactaacatggctggcatttcctttactgagtatggcattcaac
gtacaagcgaacactgcaccagcacaattgaataaagccgagcttgagcagcgctttgcc
aaactcggattgcaagtggaagagataaaaacctctgatatcaatggcttgcttgaagtg
caaacgtctggtggtgtgttgttctcttcgcctgatggtgagcactttatcgcgggtact
ctgtatgcgctggatggtaatggcggttatgttgatgtgctggctaaacgccaagcgcca
ctcaacgccaagaaaattgccgcattgcaagacagcatgattgagtttaaagcgcccaat
gagaaatacgcgatcaccgtatttaccgatatcacgtgtggttactgtgtgcgtctgcac
agccagatcaaagagtacaatgatctcggcattacggtgcgttatctcgcctacccgcgt
caggggccgcaaggtcaagtcgcggatcaaatggcggccatctggtgttctaacgatccg
aaagcggcgatgcacgatgcgaaagtgaatcgtaaaaccattaccgccgataaagatatc
gcccaatgccaaaagaccatcgcgcagcactatatgctgggtcacgagctcggcattagc
ggtactccagcgattttcttacccaatggtgagatggttggcggctatttgcctgcgccg
caattgctgcaacgcctgcaagccacacaatag

DBGET integrated database retrieval system