KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC2502Help
Entry
VC2502            CDS       T00034                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    VC2502
   00240 Pyrimidine metabolism
    VC2502
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    VC2502
   03430 Mismatch repair
    VC2502
   03440 Homologous recombination
    VC2502
Enzymes [BR:vch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     VC2502
DNA replication proteins [BR:vch03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     VC2502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
I:2688155..2688604
Genome map
AA seq 149 aa AA seqDB search
MPTATFYLISRDSAQATPEGLAQYVLYLTRHFAAQGARIYLQCQDKPHAEQLAERFWQIE
PEQFLAHNLVGEGPKSGTAIEIGYVGVSPSWNRQLAINLADNQTTFARTFTEVVDFVPCA
ENAKQLARERYKLYRQAGYQLQTVEIQYP
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgcctaccgcaactttttacctgatttcccgagattctgctcaagcaacgccagaaggc
ttggcgcagtacgtgctgtatttgacgcgtcactttgccgcgcaaggcgcacgcatttat
ctgcaatgccaagataaaccacatgccgagcagctagctgagcgattttggcaaatcgaa
cccgaacagtttttagcgcacaatctggtcggtgaaggtcccaaatccggtaccgcgatt
gagataggttatgtgggcgtttccccctcttggaatcgtcaactggcaataaatttggcg
gataatcagacaacctttgcgcgtacctttaccgaggtggtagacttcgtgccctgcgca
gaaaatgccaagcagctggcgcgcgagcggtataaactctatcgacaagcaggttatcag
ctgcaaactgttgagattcagtatccataa

DBGET integrated database retrieval system