KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC2502Help
Entry
VC2502            CDS       T00034                                 

Definition
(RefSeq) DNA polymerase III subunit chi
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
vch00230  Purine metabolism
vch00240  Pyrimidine metabolism
vch01100  Metabolic pathways
vch03030  DNA replication
vch03430  Mismatch repair
vch03440  Homologous recombination
Module
vch_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    VC2502
   00240 Pyrimidine metabolism
    VC2502
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    VC2502
   03430 Mismatch repair
    VC2502
   03440 Homologous recombination
    VC2502
Enzymes [BR:vch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     VC2502
DNA replication proteins [BR:vch03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     VC2502
DNA repair and recombination proteins [BR:vch03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     VC2502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi GlgS Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 2615166
NCBI-ProteinID: NP_232131
UniProt: Q9KP74
Position
I:2688155..2688604
Genome map
AA seq 149 aa AA seqDB search
MPTATFYLISRDSAQATPEGLAQYVLYLTRHFAAQGARIYLQCQDKPHAEQLAERFWQIE
PEQFLAHNLVGEGPKSGTAIEIGYVGVSPSWNRQLAINLADNQTTFARTFTEVVDFVPCA
ENAKQLARERYKLYRQAGYQLQTVEIQYP
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgcctaccgcaactttttacctgatttcccgagattctgctcaagcaacgccagaaggc
ttggcgcagtacgtgctgtatttgacgcgtcactttgccgcgcaaggcgcacgcatttat
ctgcaatgccaagataaaccacatgccgagcagctagctgagcgattttggcaaatcgaa
cccgaacagtttttagcgcacaatctggtcggtgaaggtcccaaatccggtaccgcgatt
gagataggttatgtgggcgtttccccctcttggaatcgtcaactggcaataaatttggcg
gataatcagacaacctttgcgcgtacctttaccgaggtggtagacttcgtgccctgcgca
gaaaatgccaagcagctggcgcgcgagcggtataaactctatcgacaagcaggttatcag
ctgcaaactgttgagattcagtatccataa

DBGET integrated database retrieval system