KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC2510Help
Entry
VC2510            CDS       T00034                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    VC2510 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VC2510 (pyrB)
Enzymes [BR:vch01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     VC2510 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2699599..2700528
Genome map
AA seq 309 aa AA seqDB search
MANSLYQKHIISIAELSRAELELIVKTAGQLKAQPNPELIKHKVVASCFFEPSTRTRLSF
ETAIQRIGGSVIGFDNGGNTSLAKKGETLADSVRVISSYVDAFVMRHPQEGAARLASEFS
NGVPVINAGDGSNQHPSQTLLDLYSIFETQGRLDNLDVAFVGDLKYGRTVHSLAQALAKF
DNNRFYFVAPEALAMPDYICEELDEAGVKYQVFSDMESVIPELDILYMTRVQKERFDESE
YAHIKSAYILTAAHLSDARSNLKVLHPLPRVDEITTDVDKTPHAYYFEQVENGVYAREAL
LALVLNESL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggcgaattcgctttaccaaaagcacatcatctccattgctgaactctcacgcgcggag
ttggagttgattgtgaaaaccgcaggccaactgaaggcacaaccgaatccagagctgatc
aagcacaaggtcgtggccagctgtttctttgaaccttccacccgtactcgcctctcattc
gagacagcaatccaacgtatcggtggcagcgtgattggctttgataacggcggcaacacg
tcactagcgaagaaaggcgaaaccctagccgattcagtacgcgtcatctcctcttatgtt
gatgcttttgtgatgcgtcatccgcaagaaggtgccgcgcgtttagcgtctgaattttct
aacggcgtcccagtgattaacgccggtgatggttcaaaccaacacccatcgcaaaccctg
ctcgatctctactccattttcgaaacccaaggccgtctcgataacctcgatgtcgcgttc
gtcggtgatttaaaatatggtcgcaccgtgcattcgctggcacaagctctggctaaattt
gataacaaccgcttctactttgtggcaccggaagccctagcgatgccagactacatctgt
gaagagctggatgaagcaggtgtgaaataccaagtgttcagcgatatggaaagcgtgatc
ccagagctggatattctgtacatgacgcgtgtacagaaagaacgttttgatgagtcggaa
tacgcacatatcaaatcggcctatatcttgacggccgctcacctgagcgatgcgcgcagc
aatctgaaagtgctgcacccactgccacgggtggatgagatcaccactgatgtcgataaa
accccacacgcttactatttcgagcaagttgaaaacggagtttatgcccgtgaagccttg
ctggctctagttttgaacgaatcgctgtaa

DBGET integrated database retrieval system